DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y4291_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 1.509e-26
Identity = 64/160 (40.00%), Postives = 101/160 (63.12%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            P I+HRD+K++N+LL++N EA+++DFG++++    D    V+ + GTPGYV PEYY +F+ + K DVYS+G+VLLEL+TGKR     D G+  N+V +V+   K+  I  V DP L  +  +      + + VA +C+ DR   RP   Q+++  K+  A
Sbjct:  698 PPIVHRDVKTANILLNDNLEAKIADFGLSKVFPEDDLSHVVTAVMGTPGYVDPEYYNTFKLNEKSDVYSFGIVLLELITGKRSIMKTDDGEKMNVVHYVEPFLKMGDIDGVVDPRLHGDFSS--NSAWKFVEVAMSCVRDRGTNRPNTNQIVSDLKQCLA 855          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLQ_ARATH (Wall-associated receptor kinase-like 20 OS=Arabidopsis thaliana GN=WAKL20 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.509e-26
Identity = 68/156 (43.59%), Postives = 105/156 (67.31%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTL----AGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHL-HVASACLDDRPWRRPTMIQV 568
            P I HRD+KSSN+LLDE   A+VSDFG++RL+   +T  + S +     GT GY+ PEYY++F+ + K DVYS+GVVLLE++T K+  D + +  D NLV ++ K   + ++++  DP L K    I+++ +Q L ++ASACL++R   RP+M +V
Sbjct:  484 PPIYHRDVKSSNILLDEKLNAKVSDFGLSRLVDLTETANNESHIFTGAQGTLGYLDPEYYRNFQLTDKSDVYSFGVVLLEMVTSKKAIDFTREEEDVNLVMYINKMMDQERLTECIDPLLKKTANKIDMQTIQQLGNLASACLNERRQNRPSMKEV 639          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.509e-26
Identity = 71/177 (40.11%), Postives = 107/177 (60.45%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMD-THLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLK-ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGG 643
            +P I+HRD+KS+N+L+D ++ ARV+DFG+A+ +        S+S +AG+ GY+ PEY  + R + K D+YS+GVV+LE++T KRP D  + G+ +LV WV      K I  V DP+L   D   + E+ + L+V   C    P  RP+M +V+ M +EI  G   DS   I  D+ G
Sbjct:  808 VPPIVHRDIKSNNILIDGDYGARVADFGVAKAVDLTGKAPKSMSVIAGSCGYIAPEYAYTLRVNEKSDIYSFGVVILEIVTRKRPVD-PELGEKDLVKWVCSTLDQKGIEHVIDPKL---DSCFKEEISKILNVGLLCTSPLPINRPSMRRVVKMLQEI-GGGDEDSLHKIRDDKDG 979          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.971e-26
Identity = 74/179 (41.34%), Postives = 106/179 (59.22%), Query Frame = 2
Query:  107 SARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN---LVGWVKQHAK-LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            SARG+        P IIHRD+K++N+LLDE FEA V DFG+A+LM   DTH++ + + GT G++ PEY  + + S K DV+ YG++LLEL+TG+R  D A   +++   L+ WVK   K  K+  + DP+L       E+E  Q + VA  C    P  RP M +V+ M +    G GL
Sbjct:  410 SARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVT-TAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYEERELE--QVIQVALLCTQGSPMERPKMSEVVRMLE----GDGL 581          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: FEI2_ARATH (LRR receptor-like serine/threonine-protein kinase FEI 2 OS=Arabidopsis thaliana GN=FEI2 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.574e-26
Identity = 68/159 (42.77%), Postives = 103/159 (64.78%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-NLVGW----VKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFK 583
            P IIHRD+KSSN+LLD N EARVSDFG+A+L+   ++H++ + +AGT GY+ PEY QS R + K DVYS+GV++LE+L+GK PTD++      N+VGW    + ++   +I D+    + +E       L   L +A+ C+   P  RPTM +V+ + +
Sbjct:  421 PRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEESHIT-TIVAGTFGYLAPEYMQSGRATEKTDVYSFGVLVLEVLSGKLPTDASFIEKGFNIVGWLNFLISENRAKEIVDLSCEGVERE------SLDALLSIATKCVSSSPDERPTMHRVVQLLE 572          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 7.489e-26
Identity = 74/179 (41.34%), Postives = 106/179 (59.22%), Query Frame = 2
Query:  107 SARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN---LVGWVKQHAK-LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            SARG+        P IIHRD+K++N+LLDE FEA V DFG+A+LM   DTH++ + + GT G++ PEY  + + S K DV+ YGV+LLEL+TG+R  D A   +++   L+ WVK   K  K+  + D +L     + E+E  Q + VA  C    P  RP M +V+ M +    G GL
Sbjct:  397 SARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVT-TAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVE--QLIQVALLCTQSSPMERPKMSEVVRMLE----GDGL 568          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: IKU2_ARATH (Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 9.780e-26
Identity = 73/184 (39.67%), Postives = 108/184 (58.70%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSA--MDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN-LVGWVKQHAK-------LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ----AGSGLDSQSTIATDE 637
            +IHRD+KSSN+LLDE +  R++DFG+A+++ A  +    S   + GT GY+ PEY  + + + K DVYS+GVVL+EL+TGK+P ++ DFG+NN +V WV   +K       +K+ D    +  KED       L+ L +A  C D  P  RP M  V++M ++I+      SG  S    A DE
Sbjct:  810 VIHRDVKSSNILLDEEWRPRIADFGLAKIIQADSVQRDFSAPLVKGTLGYIAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPLET-DFGENNDIVMWVWSVSKETNREMMMKLIDTSIEDEYKED------ALKVLTIALLCTDKSPQARPFMKSVVSMLEKIEPSYNKNSGEASYGESANDE 986          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RPK2_ARATH (LRR receptor-like serine/threonine-protein kinase RPK2 OS=Arabidopsis thaliana GN=RPK2 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.179e-25
Identity = 69/165 (41.82%), Postives = 100/165 (60.61%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSA--DFGDN-NLVGWVKQHAKL-KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGS 601
            +P ++HRD+K SN+LLD++  A +SDFG+ARL+   +TH +   +AGT GYV PEY  + R S K DVYSYGVVLLELL+ K+  D +   +G+  N+V W     +  +  + F   L    P+   +L++ LH+A  C  D    RPTM QV+   K++Q  S
Sbjct:  989 VPRVLHRDVKPSNILLDDDCNAYLSDFGLARLLGTSETHATTG-VAGTFGYVAPEYAMTCRVSDKADVYSYGVVLLELLSDKKALDPSFVSYGNGFNIVQWACMLLRQGRAKEFFTAGLWDAGPH--DDLVEVLHLAVVCTVDSLSTRPTMKQVVRRLKQLQPPS 1150          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: RPK1_ARATH (Probable LRR receptor-like serine/threonine-protein kinase RPK1 OS=Arabidopsis thaliana GN=RPK1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.179e-25
Identity = 67/161 (41.61%), Postives = 98/161 (60.87%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKR---PTDSADFGDNNLVGWVKQH-AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ 592
            P ++HRD+K SN+LLD N+ A +SDFG+++L+    +H++   +AGT GYV PEY  + R S K DVYSYG+VLLEL++ KR   P+ S+     N+V W     ++ K  +VF   L +  P    +L++ LH+A  C  D    RPTM Q + + K IQ
Sbjct:  379 PKVLHRDIKPSNILLDNNYNAYLSDFGLSKLLGTSQSHVTTG-VAGTFGYVAPEYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEVFTTGLWETGP--PDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRIQ 536          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y2242_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 4.854e-25
Identity = 67/165 (40.61%), Postives = 100/165 (60.61%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFR--CSTKGDVYSYGVVLLELLTGKRP--TDSADFGDNNLVGWVKQHA-KLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGS 601
            P IIHRD+K+S+V LD+N+E R+SDFG+A++       L    + G+PGY+PPE+ Q      + K DVY +GVVL EL+TGK+P   D  D  D NLV WV+    K + S   DP++  ++   E ++ + L +   C  D P +RP+M QV+ + K+I+  S
Sbjct:  692 PPIIHRDVKASSVYLDQNWEPRLSDFGLAKVFG---NGLDDEIIHGSPGYLPPEFLQPEHELPTPKSDVYCFGVVLFELMTGKKPIEDDYLDEKDTNLVSWVRSLVRKNQASKAIDPKI--QETGSEEQMEEALKIGYLCTADLPSKRPSMQQVVGLLKDIEPKS 851          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
Y4291_ARATH1.509e-2640.00Probable LRR receptor-like serine/threonine-protei... [more]
WAKLQ_ARATH1.509e-2643.59Wall-associated receptor kinase-like 20 OS=Arabido... [more]
HSL1_ARATH1.509e-2640.11Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
SERK1_ARATH1.971e-2641.34Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
FEI2_ARATH2.574e-2642.77LRR receptor-like serine/threonine-protein kinase ... [more]
BAK1_ARATH7.489e-2641.34BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
IKU2_ARATH9.780e-2639.67Receptor-like protein kinase HAIKU2 OS=Arabidopsis... [more]
RPK2_ARATH2.179e-2541.82LRR receptor-like serine/threonine-protein kinase ... [more]
RPK1_ARATH2.179e-2541.61Probable LRR receptor-like serine/threonine-protei... [more]
Y2242_ARATH4.854e-2540.61Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top