DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: SERK4_ARATH (Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 4.854e-25
Identity = 71/179 (39.66%), Postives = 108/179 (60.34%), Query Frame = 2
Query:  107 SARGIPH--------IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN---LVGWVKQHAK-LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            SARG+ +        IIHRD+K++N+LLDE FEA V DFG+A+LM+  D+H++ + + GT G++ PEY  + + S K DV+ YGV+LLEL+TG++  D A   +++   L+ WVK+  K  K+  + D EL  E   +E E+ Q + +A  C       RP M +V+ M +    G GL
Sbjct:  402 SARGLAYLHDHCDQKIIHRDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVT-TAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAEL--EGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE----GDGL 573          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y4265_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 8.280e-25
Identity = 71/167 (42.51%), Postives = 99/167 (59.28%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAM-DTHLSVST------LAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQH--AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ 592
            +P IIH D+K+ NVLL  +FE  ++DFG+AR +S   +T + ++       +AG+ GY+ PE+    R + K DVYSYGVVLLE+LTGK P D    G  +LV WV+ H   K   S + DP L     +I  E+LQ L VA  C+ ++   RP M  V+AM  EI+
Sbjct:  876 LPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIR 1042          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: ERL1_ARATH (LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 8.280e-25
Identity = 68/156 (43.59%), Postives = 94/156 (60.26%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKISDVFDPELMKE-DPNIEIELLQHLHV------ASACLDDRPWRRPTMIQV 568
            P IIHRD+KSSN+LLDENFEA +SDFG+A+ + A  TH S   L GT GY+ PEY ++ R + K D+YS+G+VLLELLTGK+  D+    + NL        +L +S   D  +M+  DP + +  +   H+      A  C    P  RPTM++V
Sbjct:  767 PRIIHRDIKSSNILLDENFEAHLSDFGIAKSIPASKTHASTYVL-GTIGYIDPEYARTSRINEKSDIYSFGIVLLELLTGKKAVDN----EANL-------HQLILSKADDNTVMEAVDPEVTVTCMDLGHIRKTFQLALLCTKRNPLERPTMLEV 910          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1341_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.081e-24
Identity = 62/161 (38.51%), Postives = 99/161 (61.49%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLM-SAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL--KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQ 592
            +P I+HRD+K +N+LLD  +EA ++DFG+A+LM ++ + H ++S +AG+ GY+ PEY  +   + K DVYSYGVVLLE+L+G+   +       ++V WVK+          V D +L      I  E+LQ L +A  C++  P  RPTM +V+ +  E++
Sbjct:  893 VPAILHRDVKCNNILLDSKYEAILADFGLAKLMMNSPNYHNAMSRVAGSYGYIAPEYGYTMNITEKSDVYSYGVVLLEILSGRSAVEPQIGDGLHIVEWVKKKMGTFEPALSVLDVKLQGLPDQIVQEMLQTLGIAMFCVNPSPVERPTMKEVVTLLMEVK 1053          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLD_ARATH (Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 1.081e-24
Identity = 67/171 (39.18%), Postives = 107/171 (62.57%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDN-----NLVGWVKQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGS 601
            +SA   P I HRD+K++N+LLDE ++ +VSDFG +R ++   THL+   +AGT GYV PEY+QS + + K DVYS+GVVL+EL+TGK P+      +N     + V  VK++  L I D    E +K++ N++ +++    +A  CL+ +  +RP M +V    + I++ S
Sbjct:  538 HSAASFP-IYHRDIKTTNILLDEKYQVKVSDFGTSRSVTIDQTHLTTQ-VAGTFGYVDPEYFQSSKFTDKSDVYSFGVVLVELITGKNPSSRVQSEENRGFAAHFVAAVKENRFLDIVD----ERIKDECNLD-QVMAVAKLAKRCLNRKGKKRPNMREVSVELERIRSSS 701          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: GSO1_ARATH (LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.412e-24
Identity = 64/154 (41.56%), Postives = 93/154 (60.39%), Query Frame = 2
Query:  119 IPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSA-MDTHLSVST-LAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLKIS---DVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQ 565
            +P I+HRD+KSSNVLLD N EA + DFG+A++++   DT+   +T  A + GY+ PEY  S + + K DVYS G+VL+E++TGK PTDS    + ++V WV+ H ++  S    + DP+L    P  E    Q L +A  C    P  RP+  Q
Sbjct: 1077 VPPIVHRDIKSSNVLLDSNMEAHLGDFGLAKVLTENCDTNTDSNTWFACSYGYIAPEYAYSLKATEKSDVYSMGIVLMEIVTGKMPTDSVFGAEMDMVRWVETHLEVAGSARDKLIDPKLKPLLPFEEDAACQVLEIALQCTKTSPQERPSSRQ 1230          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: IMK2_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.845e-24
Identity = 68/178 (38.20%), Postives = 107/178 (60.11%), Query Frame = 2
Query:  110 ARGIPHI------IHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKLK-ISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQST 622
            +RG+ H+      IH ++ +SN+LLDE   A ++D+G++RLM+A      ++T AGT GY  PE+ +    S K DVYS G+++LELLTGK P +  +  D  L  WV    K +  ++VFD ELM+E  ++  ELL  L +A  C+D  P  RP   QV+   +EI+  + +++++T
Sbjct:  645 SRGLAHLHSNENMIHENLTASNILLDEQTNAHIADYGLSRLMTAAAATNVIAT-AGTLGYRAPEFSKIKNASAKTDVYSLGIIILELLTGKSPGEPTNGMD--LPQWVASIVKEEWTNEVFDLELMRETQSVGDELLNTLKLALHCVDPSPAARPEANQVVEQLEEIRPETEVETETT 819          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: SERK5_ARATH (Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 3.146e-24
Identity = 70/179 (39.11%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  107 SARGIPH--------IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNN---LVGWVKQHAK-LKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGL 607
            SARG+ +        IIH D+K++N+LLDE FEA V DFG+A+LM+  D+H++ + + GT G++ PEY  + + S K DV+ YGV+LLEL+TG++  D A   +++   L+ WVK+  K  K+  + D EL  E   +E E+ Q + +A  C       RP M +V+ M +    G GL
Sbjct:  383 SARGLAYLHDHCDQKIIHLDVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVT-TAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAEL--EGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE----GDGL 554          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: PEPR2_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.109e-24
Identity = 63/166 (37.95%), Postives = 95/166 (57.23%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVK------QHAKLKISDVFDPELMKE--DPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQA 595
            P IIHRD+K  N+L+D + E  + DFG+AR++   D+ +S +T+ GT GY+ PE       S + DVYSYGVVLLEL+TGKR  D +   D N+V WV+      +        + DP+L+ E  D  +  + +Q   +A  C D RP  RP+M  V+    ++++
Sbjct:  915 PPIIHRDIKPENILMDSDMEPHIGDFGLARILD--DSTVSTATVTGTTGYIAPENAYKTVRSKESDVYSYGVVLLELVTGKRALDRSFPEDINIVSWVRSVLSSYEDEDDTAGPIVDPKLVDELLDTKLREQAIQVTDLALRCTDKRPENRPSMRDVVKDLTDLES 1078          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y2289_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 5.367e-24
Identity = 69/183 (37.70%), Postives = 112/183 (61.20%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAM-DTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKE-DPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEM 661
            P ++HRD+K++N+LLDE+F+A+++DFG++R      +TH+S + +AGTPGY+ PEYY++ R + K DVYS+G+VLLE++T  RP         ++  WV     K  I +V DP L ++ +P     + + L +A +C++    +RPTM QV    K  Q  +  +S+  +  D G   +VEM
Sbjct:  692 PPMVHRDVKTTNILLDEHFQAKLADFGLSRSFPVGGETHVSTA-VAGTPGYLDPEYYRTNRLNEKSDVYSFGIVLLEIIT-SRPVIQQTREKPHIAAWVGYMLTKGDIENVVDPRLNRDYEPT---SVWKALEIAMSCVNPSSEKRPTMSQVTNELK--QCLTLENSKRGVREDMGSRSSVEM 867          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
SERK4_ARATH4.854e-2539.66Somatic embryogenesis receptor kinase 4 OS=Arabido... [more]
Y4265_ARATH8.280e-2542.51Probable LRR receptor-like serine/threonine-protei... [more]
ERL1_ARATH8.280e-2543.59LRR receptor-like serine/threonine-protein kinase ... [more]
Y1341_ARATH1.081e-2438.51Probable LRR receptor-like serine/threonine-protei... [more]
WAKLD_ARATH1.081e-2439.18Wall-associated receptor kinase-like 4 OS=Arabidop... [more]
GSO1_ARATH1.412e-2441.56LRR receptor-like serine/threonine-protein kinase ... [more]
IMK2_ARATH1.845e-2438.20Probably inactive leucine-rich repeat receptor-lik... [more]
SERK5_ARATH3.146e-2439.11Somatic embryogenesis receptor kinase 5 OS=Arabido... [more]
PEPR2_ARATH4.109e-2437.95Leucine-rich repeat receptor-like protein kinase P... [more]
Y2289_ARATH5.367e-2437.70Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top