DC900011

Overview
NameDC900011
Unique NameDC900011
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length850
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLM_ARATH (Wall-associated receptor kinase-like 17 OS=Arabidopsis thaliana GN=WAKL17 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.909e-21
Identity = 71/204 (34.80%), Postives = 114/204 (55.88%), Query Frame = 2
Query:  104 NSARGIPHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWVKQHAKL-----KISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELST 700
            +SA   P I HRD+KS+N+LLDE + A+V+DFG +R ++   TH + + ++GT GYV PEYY+S + + K DVYS+GV+L EL+TG +P       +   +  + +H ++     ++SD+ D  + ++D   E +++   ++A  CL  R   RP M +V    + I   S  DSQ     DE      E  E  ++E  E+ T
Sbjct:  559 HSAASSP-IYHRDIKSTNILLDEKYRAKVADFGTSRSVTIDQTHWT-TVISGTVGYVDPEYYRSSQYTEKSDVYSFGVILAELITGDKPVIMVQ--NTQEIIALAEHFRVAMKERRLSDIMDARI-RDDSKPE-QVMAVANLAMKCLSSRGRNRPNMREVFTELERI-CTSPEDSQVQNRIDE------EEEEDGVEEEEEVVT 749          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: ERECT_ARATH (LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.909e-21
Identity = 62/174 (35.63%), Postives = 102/174 (58.62%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEI----QAGSGLDSQSTIA 628
            P IIHRD+KSSN+LLD++ EAR++DFG+A+ +    +H S   + GT GY+ PEY ++ R + K DVYSYG+VLLELLT ++  D     ++NL   +  +    ++ ++ DP++     ++ + + +   +A  C   +P  RPTM QV  +        Q  +  D+ +T+A
Sbjct:  767 PRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVM-GTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDD----ESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGV-VKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSATLA 934          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1765_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g07650 OS=Arabidopsis thaliana GN=At1g07650 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.493e-21
Identity = 66/174 (37.93%), Postives = 102/174 (58.62%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGK-----RPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIAT 631
            I+HRD+K+SNVLLD++  A++SDFG+A+L    +TH+S + +AGT GY+ PEY      + K DVYS+GVV LE+++GK     RPT+   +    L+ W      +  + ++ DP L  +    E  L+  L+VA  C +  P  RPTM QV+++ +   A   L S  + +T
Sbjct:  801 IVHRDIKASNVLLDKDLNAKISDFGLAKLNDDGNTHIS-TRIAGTIGYMAPEYAMRGYLTEKADVYSFGVVALEIVSGKSNTNFRPTEDFVY----LLDWAYVLQERGSLLELVDPTLASDYSEEEAMLM--LNVALMCTNASPTLRPTMSQVVSLIEGKTAMQELLSDPSFST 967          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK18_ARATH (Cysteine-rich receptor-like protein kinase 18 OS=Arabidopsis thaliana GN=CRK18 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 2.493e-21
Identity = 57/153 (37.25%), Postives = 92/153 (60.13%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD--SADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAM 577
            IIHRD+K+SN+LLD +   +++DFGMAR+     T  +   + GT GY+ PEY    + S K DVYS+GV++LE+++GK+ +     D   NNLV +V K      + ++ DP  + +D   E E+++++H+   C+ + P  RPTM  +  M
Sbjct:  460 IIHRDLKASNILLDADMNPKIADFGMARIFGVDQTVANTGRVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKNSSFYQMDGLVNNLVTYVWKLWENKSLHELLDP-FINQDFTSE-EVIRYIHIGLLCVQENPADRPTMSTIHQM 610          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5389_ARATH (Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.256e-21
Identity = 64/157 (40.76%), Postives = 94/157 (59.87%), Query Frame = 2
Query:  128 IIHRDMKSSNVLLDENFEARVSDFGMARL--MSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKR------PTDSADFGDNNLVGWVKQH-AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVM 571
            IIHRD+K++N+LLDENF A+VSDFG++R+   SA  TH+S + + GT GY+ PEYY+    + K DVYS+GVVLLE+L  +       P + AD     L+ WVK +  K  +  + D +L  +  +  +E  +   +A  C+ DR   RP M  V+
Sbjct:  649 IIHRDIKTTNILLDENFVAKVSDFGLSRVGPTSASQTHVS-TVVKGTFGYLDPEYYRRQILTEKSDVYSFGVVLLEVLCCRPIRMQSVPPEQAD-----LIRWVKSNFNKRTVDQIIDSDLTADITSTSME--KFCEIAIRCVQDRGMERPPMNDVV 797          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y5188_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.256e-21
Identity = 71/195 (36.41%), Postives = 108/195 (55.38%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTL-AGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKE-DPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQSTIATDEGGFGTVEMVEMSIQEAPELS 697
            P ++HRD+K++N+LL+E + A+++DFG++R    +D    VST+ AGTPGY+ PEYY++   S K DVYS+GVVLLE++T +  TD       ++  WV     K  I  + DP+LM + D N   ++++   +A AC++    RRPTM  V+    E  A      Q        G+     V+ S   A E S
Sbjct:  684 PPMVHRDVKTTNILLNERYGAKLADFGLSRSFP-VDGESHVSTVVAGTPGYLDPEYYRTNWLSEKSDVYSFGVVLLEIVTNQPVTDKTR-ERTHINEWVGSMLTKGDIKSILDPKLMGDYDTNGAWKIVE---LALACVNPSSNRRPTMAHVVTELNECVALENARRQGREEMHTSGY-----VDFSRSSASEFS 868          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: WAKLO_ARATH (Wall-associated receptor kinase-like 14 OS=Arabidopsis thaliana GN=WAKL14 PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.256e-21
Identity = 64/172 (37.21%), Postives = 98/172 (56.98%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTD-SADFGDNNLVGW-VKQHAKLKISDVFDPELMKEDPNIEIELLQHLH----VASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQS 619
            P I HRD+KS+N+LLD +F ++V+DFG++RL     +H+S +   GTPGY+ P+Y+Q F  S K DVYS+GVVL E++TG +  D +    + NL    V +     I ++ DP L   D +++   L  +H    +A  CL      RPTM +V    ++I+    + S S
Sbjct:  466 PPIYHRDIKSTNILLDYDFNSKVADFGLSRLGMTESSHISTAP-QGTPGYLDPQYHQCFHLSDKSDVYSFGVVLAEIITGLKVVDFTRPHTEINLAALAVDKIGSGCIDEIIDPIL---DLDLDAWTLSSIHTVAELAFRCLAFHSDMRPTMTEVADELEQIRLSGWIPSMS 633          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: CRK13_ARATH (Cysteine-rich receptor-like protein kinase 13 OS=Arabidopsis thaliana GN=CRK13 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.256e-21
Identity = 63/173 (36.42%), Postives = 93/173 (53.76%), Query Frame = 2
Query:   95 LVPNSARGI--------PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV----KQHAKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAM 577
            ++  +ARGI        P IIHRD+K+ N+LLD +   +V+DFG AR+     +    +  AGTPGY+ PEY +    S K DVYSYGV++LE++ GKR T S      N V +V    K    L + D    E  K +     E+++ +H+A  C+ + P  RP    +M+M
Sbjct:  460 IIGGTARGILYLHQDSQPTIIHRDLKAGNILLDAHMNPKVADFGTARIFGMDQSVAITANAAGTPGYMAPEYMELGEFSMKSDVYSYGVLVLEIICGKRNT-SFSSPVQNFVTYVWRLWKSGTPLNLVDATIAENYKSE-----EVIRCIHIALLCVQEEPTDRPDFSIIMSM 626          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.252e-21
Identity = 62/169 (36.69%), Postives = 95/169 (56.21%), Query Frame = 2
Query:  125 HIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVST-LAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSADFGDNNLVGWV-KQHAKLKISDVFDPELMKEDPNIE--IELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQS 619
            +++H D+K  NVL D +FEA +SDFG+ RL     +  +V+    GT GYV PE   S   + + D+YS+G+VLLE+LTGKRP       D ++V WV KQ  + +++++ +P L++ DP      E L  + V   C    P  RPTM  V+ M +  + G  + S +
Sbjct:  961 NMVHGDIKPQNVLFDADFEAHISDFGLDRLTIRSPSRSAVTANTIGTLGYVSPEATLSGEITRESDIYSFGIVLLEILTGKRPVMFTQ--DEDIVKWVKKQLQRGQVTELLEPGLLELDPESSEWEEFLLGIKVGLLCTATDPLDRPTMSDVVFMLEGCRVGPDVPSSA 1127          
BLAST of DC900011 vs. ExPASy Swiss-Prot
Match: Y1699_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g69990 OS=Arabidopsis thaliana GN=At1g69990 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.252e-21
Identity = 61/169 (36.09%), Postives = 97/169 (57.40%), Query Frame = 2
Query:  122 PHIIHRDMKSSNVLLDENFEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRP---TDSADFGDNNLVGWVKQH-AKLKISDVFDPELMKEDPNIEIELLQHLHVASACLDDRPWRRPTMIQVMAMFKEIQAGSGLDSQ 616
            P  +H+ + S+ +LLDE+F+ARV D+G+ +L+S+ D+  S S   G  GYV PEY  +   S  GDVY +G+VLLE++TG++P    +  +    +LV WV +H +  +  D  D  +  +    + E++Q L +A +C+  RP  RP MIQV    K +    G  S+
Sbjct:  410 PLYMHQYISSNVILLDEDFDARVIDYGLGKLVSSQDSKDS-SFSNGKFGYVAPEYSSTMVASLSGDVYGFGIVLLEIVTGQKPVLINNGEEGFKESLVEWVSKHLSNGRSKDAIDRRIFGK--GYDDEIMQVLRIACSCVVSRPKERPLMIQVYESLKNLGDQHGFFSE 575          
The following BLAST results are available for this feature:
BLAST of DC900011 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 291
Match NameE-valueIdentityDescription
WAKLM_ARATH1.909e-2134.80Wall-associated receptor kinase-like 17 OS=Arabido... [more]
ERECT_ARATH1.909e-2135.63LRR receptor-like serine/threonine-protein kinase ... [more]
Y1765_ARATH2.493e-2137.93Probable LRR receptor-like serine/threonine-protei... [more]
CRK18_ARATH2.493e-2137.25Cysteine-rich receptor-like protein kinase 18 OS=A... [more]
Y5389_ARATH3.256e-2140.76Probable receptor-like protein kinase At5g38990 OS... [more]
Y5188_ARATH3.256e-2136.41Probable LRR receptor-like serine/threonine-protei... [more]
WAKLO_ARATH3.256e-2137.21Wall-associated receptor kinase-like 14 OS=Arabido... [more]
CRK13_ARATH3.256e-2136.42Cysteine-rich receptor-like protein kinase 13 OS=A... [more]
Y4361_ARATH4.252e-2136.69Probable LRR receptor-like serine/threonine-protei... [more]
Y1699_ARATH4.252e-2136.09Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900011 VSS Citrus sinensis cDNA clone VS27Q22 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900011 ID=DC900011|Name=DC900011|organism=Citrus sinensis|type=EST|length=850bp
GTTTTTTTTTTTTTTTTTTTAGAGAAAATAGAAATTTTTATATATTAAAA
GGGAAAGGAAGAAACAGACTAGAAAAAAAAAAACTCGAGACTAGCTCGTG
CCGAATTCGGCACGAGGCATCCCACACATTATCCACCGGGATATGAAATC
GAGCAATGTTCTGCTAGACGAAAACTTTGAGGCCAGAGTCTCAGATTTTG
GAATGGCAAGACTAATGAGTGCGATGGATACACATTTGAGTGTCAGTACG
CTAGCAGGCACACCCGGCTATGTCCCTCCCGAATACTATCAAAGCTTTAG
ATGTTCGACGAAAGGCGATGTTTACAGTTATGGTGTAGTTTTGCTCGAGT
TGCTAACGGGAAAAAGGCCAACAGATTCAGCAGATTTCGGTGACAATAAC
CTAGTTGGGTGGGTAAAGCAGCATGCGAAGCTGAAAATAAGCGATGTCTT
TGATCCAGAACTCATGAAAGAGGATCCAAACATCGAGATTGAGCTTCTTC
AACACTTGCATGTAGCGAGTGCTTGCCTGGATGATCGACCATGGAGGAGA
CCGACAATGATTCAGGTTATGGCAATGTTTAAAGAAATCCAAGCCGGTTC
AGGACTTGACTCGCAATCTACTATTGCCACTGATGAAGGAGGTTTCGGTA
CAGTCGAAATGGTAGAGATGAGCATCCAAGAAGCTCCAGAACTAAGCACC
AAGCCTTAGNCCATTCAATTTTCAGGACAAGCATTCTTTCAGTGCCCCAA
AATTTTCCCACTTGAAAACCAAAAAAGTTGCCTTTGGTATCTCTACCATT
TAGTGTATGTAATCTTTGTATCCCTTTTGAAAATTCTTGTTATTTATACA
back to top