DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y1848_ARATH (Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana GN=RKL1 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.960e-19
Identity = 49/98 (50.00%), Postives = 67/98 (68.37%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            FDL++LL+ASA VLGK   G  YK VL+    +AV+RL +      KEF+ ++E +G + H N+V LRAYY+S DE LL+YD++P GSL+  LHG  G
Sbjct:  364 FDLEDLLRASAEVLGKGTFGTAYKAVLDAVTVVAVKRLKDV-MMADKEFKEKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHGNRG 460          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: IMK2_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.960e-19
Identity = 51/106 (48.11%), Postives = 68/106 (64.15%), Query Frame = 2
Query:  221 LVPLDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWS-VDENLLIYDYIPNGSLAXALHGK 535
            LV  D    F  D+LL A+A ++GKS  G  YK  LEDG  +AV+RL E  ++  KEF+ EV A+GKIRH N++ LRAYY     E LL++DY+  GSL+  LH +
Sbjct:  521 LVHFDGPFVFTADDLLCATAEIMGKSTYGTAYKATLEDGNEVAVKRLREKTTKGVKEFEGEVTALGKIRHQNLLALRAYYLGPKGEKLLVFDYMSKGSLSAFLHAR 626          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y3288_ARATH (Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.918e-18
Identity = 49/98 (50.00%), Postives = 64/98 (65.31%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            FDLD LLKASA VLGK  +G  YK   E GL +AV+RL +      KEF+  +  +G + H N+VTL AYY+S DE LL+++Y+  GSL+  LHG  G
Sbjct:  338 FDLDGLLKASAEVLGKGTVGSSYKASFEHGLVVAVKRLRDVVVPE-KEFRERLHVLGSMSHANLVTLIAYYFSRDEKLLVFEYMSKGSLSAILHGNKG 434          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5659_ARATH (Probable inactive receptor kinase At5g16590 OS=Arabidopsis thaliana GN=At5g16590 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.274e-18
Identity = 48/98 (48.98%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            FDLD LLKASA VLGK   G  YK   + GL +AV+RL +      KEF+ +++ +G I H N+VTL AYY+S DE L++++Y+  GSL+  LHG  G
Sbjct:  336 FDLDGLLKASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPE-KEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKG 432          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y4294_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.274e-18
Identity = 48/106 (45.28%), Postives = 67/106 (63.21%), Query Frame = 2
Query:  230 LDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYW--SVDENLLIYDYIPNGSLAXALHGKPG 541
            LD  +    +EL +A A VLG+S  G  Y+  L++G+ L V+ L EG +++ KEF  EV+    IRHPN+VTLR YYW  +  E L++ DYI  GSLA  L+ +PG
Sbjct:  741 LDDSIKLTPEELSRAPAEVLGRSSHGTSYRATLDNGVFLTVKWLREGVAKQRKEFAKEVKKFSNIRHPNVVTLRGYYWGPTQHEKLILSDYISPGSLASFLYDRPG 846          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5168_ARATH (Probably inactive receptor-like protein kinase At5g41680 OS=Arabidopsis thaliana GN=At5g41680 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 6.171e-17
Identity = 45/96 (46.88%), Postives = 62/96 (64.58%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            FDLD+LL ASA +LGK      YKV +ED  T+ V+RL E    R +EF+ ++E +G+IRH N+  L+AYY+S  + L +Y Y   G+L   LHGK
Sbjct:   52 FDLDDLLAASAEILGKGAHVTTYKVAVEDTATVVVKRLEEVVVGR-REFEQQMEIVGRIRHDNVAELKAYYYSKIDKLAVYSYYSQGNLFEMLHGK 146          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5720_ARATH (Probable inactive receptor kinase At5g67200 OS=Arabidopsis thaliana GN=At5g67200 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.063e-16
Identity = 41/101 (40.59%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  236 TQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKE--FQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            +Q  + +++L++ASA +LG+  +GI YK VL++ L + V+RL    +    E  F+  +E +G +RH N+V +R+Y+ S  E L+IYDY PNGSL   +HG
Sbjct:  382 SQGMYTMEQLMRASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDYHPNGSLFNLIHG 482          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y1061_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At1g50610 OS=Arabidopsis thaliana GN=At1g50610 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.776e-15
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 2
Query:  248 FDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            FDL +LL+ASA VLG    G  YK  +  G TL V+R     +    EF   +  +G++ HPNI+ L AYY+  +E LL+ +++PN SLA  LH
Sbjct:  368 FDLQDLLRASAEVLGSGTFGASYKAAISSGQTLVVKRYKHMNNVGRDEFHEHMRRLGRLNHPNILPLVAYYYRREEKLLVTEFMPNSSLASHLH 461          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.776e-15
Identity = 43/106 (40.57%), Postives = 62/106 (58.49%), Query Frame = 2
Query:  233 DTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            D+     LD++LK++     A ++G  G G+VYK  L DG  +A++RL     Q  +EFQ EVE + + +HPN+V L  Y    ++ LLIY Y+ NGSL   LH K
Sbjct:  726 DSNNELSLDDILKSTSSFNQANIIGCGGFGLVYKATLPDGTKVAIKRLSGDTGQMDREFQAEVETLSRAQHPNLVHLLGYCNYKNDKLLIYSYMDNGSLDYWLHEK 831          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5020_ARATH (Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 1.681e-14
Identity = 45/106 (42.45%), Postives = 62/106 (58.49%), Query Frame = 2
Query:  218 DLVPLDTQVAFDLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWS--VDENLLIYDYIPNGSLAXALH 529
            +L  LD  +    +EL +A A VLG+S  G +YK  L++G  L V+ L  G  +  K+F  E + IG ++HPNIV LRAYYW     E LL+ DY+   SLA  L+
Sbjct:  751 ELFFLDVSLKLTAEELSRAPAEVLGRSSHGTLYKATLDNGHMLTVKWLRVGLVRHKKDFAREAKKIGSLKHPNIVPLRAYYWGPREQERLLLSDYLRGESLAMHLY 856          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
Y1848_ARATH2.960e-1950.00Probable inactive receptor kinase At1g48480 OS=Ara... [more]
IMK2_ARATH2.960e-1948.11Probably inactive leucine-rich repeat receptor-lik... [more]
Y3288_ARATH1.918e-1850.00Probable inactive receptor kinase At3g02880 OS=Ara... [more]
Y5659_ARATH4.274e-1848.98Probable inactive receptor kinase At5g16590 OS=Ara... [more]
Y4294_ARATH4.274e-1845.28Probable LRR receptor-like serine/threonine-protei... [more]
Y5168_ARATH6.171e-1746.88Probably inactive receptor-like protein kinase At5... [more]
Y5720_ARATH3.063e-1640.59Probable inactive receptor kinase At5g67200 OS=Ara... [more]
Y1061_ARATH5.776e-1542.55Probably inactive leucine-rich repeat receptor-lik... [more]
PSKR1_DAUCA5.776e-1540.57Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]
Y5020_ARATH1.681e-1442.45Probable inactive receptor kinase At5g10020 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top