DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y5614_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana GN=At1g56140 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 45/120 (37.50%), Postives = 64/120 (53.33%), Query Frame = 2
Query:  179 DESETLSENVEQYDLVPLDTQVAF-DLDELLKASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            D+ E LS +V+ Y     + + A  D D   K     LG+ G G VYK  L DG  +AV+ L  G  Q   +F  E+ AI  ++H N+V L    +  +  LL+Y+Y+PNGSL  AL G+
Sbjct:  667 DDEEILSMDVKPYTFTYSELKSATQDFDPSNK-----LGEGGFGPVYKGKLNDGREVAVKLLSVGSRQGKGQFVAEIVAISAVQHRNLVKLYGCCYEGEHRLLVYEYLPNGSLDQALFGE 781          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y2296_ARATH (Probable receptor-like protein kinase At2g42960 OS=Arabidopsis thaliana GN=At2g42960 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 36/83 (43.37%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            VLG+ G G+VY+  L +G  +AV++L     Q  KEF+ EVEAIG +RH N+V L  Y       +L+Y+Y+ +G+L   LHG
Sbjct:  188 VLGEGGYGVVYRGKLVNGTEVAVKKLLNNLGQAEKEFRVEVEAIGHVRHKNLVRLLGYCIEGVHRMLVYEYVNSGNLEQWLHG 270          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y2232_ARATH (Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 32/83 (38.55%), Postives = 51/83 (61.45%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            ++GK G G VYK +L DG   A++R   G  Q   EFQTE++ + +IRH ++V+L  Y     E +L+Y+++  G+L   L+G
Sbjct:  493 LIGKGGFGYVYKAILPDGTKAAIKRGKTGSGQGILEFQTEIQVLSRIRHRHLVSLTGYCEENSEMILVYEFMEKGTLKEHLYG 575          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: PSYR1_ARATH (Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 39/98 (39.80%), Postives = 56/98 (57.14%), Query Frame = 2
Query:  260 ELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            ELLKA+     A ++G  G G+VYK  L++G  LAV++L        KEF+ EVE + + +H N+V L+ Y       +LIY ++ NGSL   LH  P
Sbjct:  795 ELLKATDNFSQANIIGCGGFGLVYKATLDNGTKLAVKKLTGDYGMMEKEFKAEVEVLSRAKHENLVALQGYCVHDSARILIYSFMENGSLDYWLHENP 892          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: ERECT_ARATH (LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 35/84 (41.67%), Postives = 53/84 (63.10%), Query Frame = 2
Query:  281 FVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            +++G      VYK VL++   +A++RL     Q  K+F+TE+E +  I+H N+V+L+AY  S   +LL YDY+ NGSL   LHG
Sbjct:  652 YIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHG 735          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BRL2_ARATH (Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 34/87 (39.08%), Postives = 55/87 (63.22%), Query Frame = 2
Query:  272 ASAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            ++A ++G  G G V+K  L+DG ++A+++L     Q  +EF  E+E +GKI+H N+V L  Y    +E LL+Y+++  GSL   LHG
Sbjct:  839 SAASMIGHGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKIGEERLLVYEFMQYGSLEEVLHG 925          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 44/118 (37.29%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  188 ETLSENVEQYDLVPLDTQVAFDLDELLKA--SAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            E LS N+  ++  PL      DL E      +  ++G  G G VYK  L+DG  +A+++L     Q  +EF  E+E IGKI+H N+V L  Y    +E LL+Y+Y+  GSL   LH +
Sbjct:  860 EALSINLAAFEK-PLRKLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSVVAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSLEDVLHDR 976          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.504e-12
Identity = 44/118 (37.29%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  188 ETLSENVEQYDLVPLDTQVAFDLDELLKA--SAFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            E LS N+  ++  PL      DL E      +  ++G  G G VYK  L+DG  +A+++L     Q  +EF  E+E IGKI+H N+V L  Y    +E LL+Y+Y+  GSL   LH +
Sbjct:  860 EALSINLAAFEK-PLRKLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSVVAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSLEDVLHDR 976          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: LRKA3_ARATH (Lectin-domain containing receptor kinase A4.3 OS=Arabidopsis thaliana GN=LECRKA4.3 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12
Identity = 35/86 (40.70%), Postives = 54/86 (62.79%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLT-LAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            V+G  G GIVY+  +      +AV+++     Q  +EF  E+E++G++RH N+V L+ +    ++ LLIYDYIPNGSL   L+ KP
Sbjct:  368 VVGTGGFGIVYRGNIRSSSDQIAVKKITPNSMQGVREFVAEIESLGRLRHKNLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKP 453          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: LRKA1_ARATH (Lectin-domain containing receptor kinase A4.1 OS=Arabidopsis thaliana GN=LECRKA4.1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12
Identity = 34/85 (40.00%), Postives = 53/85 (62.35%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            ++G  G G V+K  L +   +AV+++     Q  +EF  E+E++GK+RH N+V L+ +    ++ LLIYDYIPNGSL   L+  P
Sbjct:  372 IIGTGGFGTVFKGKLPNSDPIAVKKIIPSSRQGVREFVAEIESLGKLRHKNLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVP 456          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
Y5614_ARATH3.504e-1237.50Probable LRR receptor-like serine/threonine-protei... [more]
Y2296_ARATH3.504e-1243.37Probable receptor-like protein kinase At2g42960 OS... [more]
Y2232_ARATH3.504e-1238.55Probable receptor-like protein kinase At2g23200 OS... [more]
PSYR1_ARATH3.504e-1239.80Tyrosine-sulfated glycopeptide receptor 1 OS=Arabi... [more]
ERECT_ARATH3.504e-1241.67LRR receptor-like serine/threonine-protein kinase ... [more]
BRL2_ARATH3.504e-1239.08Serine/threonine-protein kinase BRI1-like 2 OS=Ara... [more]
BRI1_SOLPE3.504e-1237.29Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC3.504e-1237.29Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
LRKA3_ARATH7.807e-1240.70Lectin-domain containing receptor kinase A4.3 OS=A... [more]
LRKA1_ARATH7.807e-1240.00Lectin-domain containing receptor kinase A4.1 OS=A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top