DC900003

Overview
NameDC900003
Unique NameDC900003
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length545
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5630 contig Csv1_Contig5630:1..545. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: HSL1_ARATH (Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12
Identity = 42/101 (41.58%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKE---------------FQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKPG 541
            V+G    G VYKVVL +G T+AV+RL  G  +   +               F+ EVE +GKIRH NIV L     + D  LL+Y+Y+PNGSL   LH   G
Sbjct:  681 VIGAGASGKVYKVVLTNGETVAVKRLWTGSVKETGDCDPEKGYKPGVQDEAFEAEVETLGKIRHKNIVKLWCCCSTRDCKLLVYEYMPNGSLGDLLHSSKG 781          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK26_ARATH (Cysteine-rich receptor-like protein kinase 26 OS=Arabidopsis thaliana GN=CRK26 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12
Identity = 43/122 (35.25%), Postives = 66/122 (54.10%), Query Frame = 2
Query:  164 LCFRKDESETLSENVEQYDLVPLDTQVAFDLDELLKASAFV-----LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            L  R+ E+   SEN  + + +  D+ + FD   L  A++       LG+ G G VYK VL DG  +AV+RL +   Q   EF+ E   + K++H N+V L  Y     E LL+Y+++P+ SL
Sbjct:  305 LKLRRKENIRNSENKHENENISTDS-MKFDFSVLQDATSHFSLENKLGEGGFGAVYKGVLSDGQKIAVKRLSKNAQQGETEFKNEFLLVAKLQHRNLVKLLGYSIEGTERLLVYEFLPHTSL 425          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK19_ARATH (Cysteine-rich receptor-like protein kinase 19 OS=Arabidopsis thaliana GN=CRK19 PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 7.807e-12
Identity = 33/76 (43.42%), Postives = 48/76 (63.16%), Query Frame = 2
Query:  287 LGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            LG+ G G VYK  L  GL +AV+RL +   Q  KEF+ EV  + K++H N+V L  Y    +E +L+Y+++PN SL
Sbjct:  332 LGQGGFGEVYKGTLSSGLQVAVKRLSKTSGQGEKEFENEVVVVAKLQHRNLVKLLGYCLEGEEKILVYEFVPNKSL 407          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y4361_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11
Identity = 34/82 (41.46%), Postives = 50/82 (60.98%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYY-WSVDENLLIYDYIPNGSLAXAL 526
            VL ++  G+++K    DG+ L++RRL  G       F+ E E +GK++H NI  LR YY    D  LL+YDY+PNG+L+  L
Sbjct:  846 VLSRTRYGLLFKANYNDGMVLSIRRLPNGSLLNENLFKKEAEVLGKVKHRNITVLRGYYAGPPDLRLLVYDYMPNGNLSTLL 927          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: SERK4_ARATH (Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11
Identity = 49/128 (38.28%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFK-EFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            RK +        E+   V L     F L ELL A+       VLG+ G G VYK  L DG  +AV+RL E  ++  + +FQTEVE I    H N++ LR +  +  E LL+Y Y+ NGS+A  L  +P
Sbjct:  257 RKPQDHFFDVPAEEDPEVHLGQLKRFTLRELLVATDNFSNKNVLGRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERP 384          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: CRK27_ARATH (Cysteine-rich receptor-like protein kinase 27 OS=Arabidopsis thaliana GN=CRK27 PE=2 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSL 514
            R+ + +TL EN E  +    D+ + FD + +  A+        +G+ G G+VYK  L DGL +AV+RL     Q   EF+TEV  + K++H N+V L  +     E LL+Y++IPN SL
Sbjct:  298 RRRKKKTLKENAEN-EFESTDS-LHFDFETIRVATDDFSLTNKIGEGGFGVVYKGHLPDGLEIAVKRLSIHSGQGNAEFKTEVLLMTKLQHKNLVKLFGFSIKESERLLVYEFIPNTSL 414          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11
Identity = 36/84 (42.86%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGK 535
            ++G  G G VYK  L DG  +A+++L     Q  +EF  E+E IGKI+H N+V L  Y    +E LL+Y+Y+  GSL   LH K
Sbjct:  864 MVGSGGFGEVYKAQLRDGSVVAIKKLIRITGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKWGSLETVLHEK 947          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.020e-11
Identity = 48/128 (37.50%), Postives = 66/128 (51.56%), Query Frame = 2
Query:  173 RKDESETLSENVEQYDLVPLDTQVAFDLDELLKAS-----AFVLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFK-EFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHGKP 538
            +K +        E+   V L     F L EL  AS       +LG+ G G VYK  L DG  +AV+RL E  +Q  + +FQTEVE I    H N++ LR +  +  E LL+Y Y+ NGS+A  L  +P
Sbjct:  252 KKPQDHFFDVPAEEDPEVHLGQLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERP 379          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: Y3804_ARATH (Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.332e-11
Identity = 37/92 (40.22%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  260 ELLKASAFVLGKSGIGIVYKVVL-EDGLTLAVRRLGEGGS-QRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALH 529
            E L   A  +G+   G VYK  L E G  LAV++L      Q  ++F  EV  + K +HPN+V+++ Y+W+ D +LL+ +YIPNG+L   LH
Sbjct:  723 ESLLNKASRIGEGVFGTVYKAPLGEQGRNLAVKKLVPSPILQNLEDFDREVRILAKAKHPNLVSIKGYFWTPDLHLLVSEYIPNGNLQSKLH 814          
BLAST of DC900003 vs. ExPASy Swiss-Prot
Match: THE1_ARATH (Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.332e-11
Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  284 VLGKSGIGIVYKVVLEDGLTLAVRRLGEGGSQRFKEFQTEVEAIGKIRHPNIVTLRAYYWSVDENLLIYDYIPNGSLAXALHG 532
            +LG  G G VYK  LEDG  +AV+R      Q   EF+TE+E + K+RH ++V+L  Y     E +L+Y+Y+ NG L   L+G
Sbjct:  515 LLGVGGFGRVYKGTLEDGTKVAVKRGNPRSEQGMAEFRTEIEMLSKLRHRHLVSLIGYCDERSEMILVYEYMANGPLRSHLYG 597          
The following BLAST results are available for this feature:
BLAST of DC900003 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
HSL1_ARATH7.807e-1241.58Receptor-like protein kinase HSL1 OS=Arabidopsis t... [more]
CRK26_ARATH7.807e-1235.25Cysteine-rich receptor-like protein kinase 26 OS=A... [more]
CRK19_ARATH7.807e-1243.42Cysteine-rich receptor-like protein kinase 19 OS=A... [more]
Y4361_ARATH1.020e-1141.46Probable LRR receptor-like serine/threonine-protei... [more]
SERK4_ARATH1.020e-1138.28Somatic embryogenesis receptor kinase 4 OS=Arabido... [more]
CRK27_ARATH1.020e-1136.97Cysteine-rich receptor-like protein kinase 27 OS=A... [more]
BRL1_ARATH1.020e-1142.86Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
BAK1_ARATH1.020e-1137.50BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
Y3804_ARATH1.332e-1140.22Probably inactive leucine-rich repeat receptor-lik... [more]
THE1_ARATH1.332e-1142.17Receptor-like protein kinase THESEUS 1 OS=Arabidop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900003 VSS Citrus sinensis cDNA clone VS27Q14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900003 ID=DC900003|Name=DC900003|organism=Citrus sinensis|type=EST|length=545bp
AGGGCTTAGTAAGAGTGCTATAGTAGCTATAATTGTGAGTGATGTAATTG
GAATTTGCCTTGTCGGGCTATTGTTCTCATATTGTTATTCAAGGGTTTGT
GGTTTTGGCGAGGGCAAGGATGAAAATTGTTATGCAAAAGGAGGTAAGGG
AAGANAAGAGTGCTTGTGCTTCAGGAAAGATGAATCAGAGACTCTCTCAG
AGAATGTTGAACAGTATGACCTTGTGCCGCTGGATACACAGGTGGCTTTT
GATTTGGATGAGCTGCTTAAGGCTTCAGCTTTTGTTCTTGGCAAGAGTGG
AATTGGGATTGTATACAAAGTTGTGCTTGAAGATGGACTTACTTTAGCCG
TGAGAAGGTTGGGTGAAGGCGGCTCTCAGAGGTTTAAGGAGTTCCAAACC
GAAGTAGAAGCAATTGGGAAGATAAGGCATCCAAACATTGTAACTCTCAG
AGCATATTACTGGTCTGTTGATGAGAACCTGCTCATATATGATTATATAC
CTAATGGAAGCCTAGCCNCTGCACTCCATGGGAAGCCAGGAATGG
back to top