DC899998

Overview
NameDC899998
Unique NameDC899998
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length870
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2224 contig Csv1_Contig2224:197..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: GUB_CLOTM (Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.285e-12
Identity = 54/167 (32.34%), Postives = 80/167 (47.90%), Query Frame = 2
Query:    8 NNGQLLSLSLDKASGSGFQSKS-EY----LFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPI-REFKNLESNGVLFPKNQPMRIYSSLW---NADDWATR 472
            +NG+++ L+LD+  G  +  KS EY     FG    ++++    + G V++++     S  + WDEID EFLG    D      N + N  G  E   +L FD + DFHTY   W P  I FYVDG  + R  +N+           P +I  +LW     D+W  R
Sbjct:   72 SNGKMI-LTLDREYGGSYPYKSGEYRSKSFFGYGYYEVRMKAAKNVGIVSSFFTYTGPSDNNPWDEIDIEFLGK---DTTKAQFNWYKNEVGGNEYLHNLGFDASQDFHTYGFEWRPDYIDFYVDGKKVYRGTRNIPVT--------PGKIMMNLWPGKGVDEWLGR 226          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: CRH1_YEAST (Probable glycosidase CRH1 OS=Saccharomyces cerevisiae GN=CRH1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.882e-12
Identity = 53/172 (30.81%), Postives = 84/172 (48.84%), Query Frame = 2
Query:   23 LSLSLDKA-SGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQ--QFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLWNADDWATRGGLI-----KTDWTQAPFT 514
            LS++L K       +S    ++GK+++ LK    N  G V+++YL+S     DEID E++G   GD     +N F+ G        +FH    PT  FH Y++ W   +  +Y+DG  +R   N  S G  +P++ PM +   +W   D     G I     +T++  APFT
Sbjct:   85 LSMTLAKRYDNPSLKSNFYIMYGKLEVILKAA--NGTGIVSSFYLQS--DDLDEIDIEWVG---GDNTQFQSNFFSKGDTTTYDRGEFHGVDTPTDKFHNYTLDWAMDKTTWYLDGESVRVLSNTSSEG--YPQS-PMYLMMGIWAGGDPDNAAGTIEWAGGETNYNDAPFT 246          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: XYND_RUMFL (Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.420e-11
Identity = 58/201 (28.86%), Postives = 93/201 (46.27%), Query Frame = 2
Query:    2 ILNNGQLLSLSLDKA-------------SGSGFQSKSEYLFGKIDMQLKLVPGNSAGTVTAYYL---KSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTADFHTYSVLWNPQRIVFYVDGSPIREFKNLESNGVLFPKNQPMRIYSSLW---NADDWATRGGLIKTDWTQAPFTASYR--NFNAN 541
            ++N+G  L LS+D+              SG  F++ + Y +G  +  ++ +  +  G V++++     S  + WDEID E LG    +   +  N +TNG+G  E+ + L FD +  +HTY   W P  I +YVDG   RE      +    PK  P +I  + W     DDW      +K    + P TA Y+   +N N
Sbjct:  608 VINDG-CLQLSIDQKWTNDKNPDWDPRYSGGEFRTNNFYHYGYYECSMQAMKND--GVVSSFFTYTGPSDDNPWDEIDIEILGK---NTTQVQFNYYTNGQGKHEKLYDLGFDSSEAYHTYGFDWQPNYIAWYVDG---REVYRATQD---IPKT-PGKIMMNAWPGLTVDDW------LKAFNGRTPLTAHYQWVTYNKN 789          
BLAST of DC899998 vs. ExPASy Swiss-Prot
Match: CRF1_ASPFU (Probable glycosidase crf1 OS=Aspergillus fumigatus GN=crf1 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 9.206e-11
Identity = 55/168 (32.74%), Postives = 80/168 (47.62%), Query Frame = 2
Query:   77 YLFGKIDMQLKLVPGNSAGTVTAYYLKSPGSTWDEIDFEFLGNLSGDPYTLHTNVFTNGKGDREQQFHLWFDPTAD----FHTYSVLWNPQRIVFYVDGSPIREFK-NLESNGVLFPKNQPMRIYSSLWNADDWATRGGLIK-----TDWTQAPFT---ASYRNFNAN 541
            + FGK ++ +K  PG   G V++  L+S     DE+D+E LG   GD   + TN F  GKGD        + P A     FHTY++ W    + + +DG+ +R    N    G  FP+  PMR+    W   D +   G I+     TD++  P+T    S R  NAN
Sbjct:   89 FFFGKAEVVMKAAPGT--GVVSSIVLES--DDLDEVDWEVLG---GDTTQVQTNYF--GKGDTTTYDRGTYVPVATPQETFHTYTIDWTKDAVTWSIDGAVVRTLTYNDAKGGTRFPQT-PMRLRLGSWAGGDPSNPKGTIEWAGGLTDYSAGPYTMYVKSVRIENAN 246          
The following BLAST results are available for this feature:
BLAST of DC899998 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 54
Match NameE-valueIdentityDescription
GUB_CLOTM1.285e-1232.34Beta-glucanase OS=Clostridium thermocellum GN=licB... [more]
CRH1_YEAST4.882e-1230.81Probable glycosidase CRH1 OS=Saccharomyces cerevis... [more]
XYND_RUMFL1.420e-1128.86Xylanase/beta-glucanase OS=Ruminococcus flavefacie... [more]
CRF1_ASPFU9.206e-1132.74Probable glycosidase crf1 OS=Aspergillus fumigatus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899998 VSS Citrus sinensis cDNA clone VS27Q09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899998 ID=DC899998|Name=DC899998|organism=Citrus sinensis|type=EST|length=870bp
GATACTCAACAACGGCCAGCTTCTCTCCCTCTCCCTTGACAAAGCCTCAG
GCTCAGGCTTCCAGTCCAAGAGCGAGTACCTTTTTGGCAAAATCGACATG
CAACTCAAGCTTGTCCCTGGCAATTCTGCCGGCACAGTCACCGCCTACTA
CTTAAAATCACCAGGATCAACATGGGATGAGATAGACTTTGAATTCTTGG
GGAATTTAAGTGGTGATCCTTATACTCTTCATACTAATGTGTTCACAAAT
GGCAAAGGTGACAGAGAGCAACAATTCCACCTCTGGTTTGACCCCACTGC
TGACTTTCACACCTATTCCGTTCTCTGGAACCCCCAACGTATTGTCTTCT
ATGTTGATGGCTCGCCAATTAGAGAGTTCAAGAACTTGGAATCAAACGGC
GTACTCTTTCCCAAAAACCAGCCGATGAGGATTTACTCGAGTCTCTGGAA
CGCCGATGACTGGGCCACGAGAGGTGGCCTTATCAAAACTGACTGGACCC
AAGCTCCCTTCACTGCTTCTTACAGAAACTTCAATGCCAATGCTTGCGTC
TGGTCTAATGGAAAATCCTCTTGCAACTCAAAAAATAATAATCCATGGTT
CTCGCAAGAACTTGATACCNCTGGCCAAGAGAGACTCAAATGGGTGCAGA
AGAATTACATGATATATAATTATTGCAAGGACTCAAAACGATTTCCCCAA
GGGCTCCCAAAAGAATGTGCATTCAATATATAACTGATCCATTTGCCATA
TGTCTTTGTTTATAGCTTTTTTAATCTTCAGTTTTGATGTTTTGGTTCTT
TTATTCTGTGTACTAATGTTTAGTGACAAATAAAATGTATGGTTCATTCT
TTTTTGTACTATAAGTGCTA
back to top