DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL52_ARATH (GDSL esterase/lipase At3g14820 OS=Arabidopsis thaliana GN=At3g14820 PE=3 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 2.198e-46
Identity = 100/274 (36.50%), Postives = 159/274 (58.03%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 822
            GK+ +D  A++LG     P YL       +LL G  FAS GSGYD  TS L   +S++ QL+Y++EY +K+ +  G ++   I++ ++++V + S D  + Y+V  +    Y    Y+  LV + S FIK +  LGA+  G+ S  P+GCLPA RTLFG  E  C  ++N  A  FN K+SS+   L+K+LP  +++  D++  + D++++P+  GF  A +             LCN  +P TCS+AS +VF+DS HPS+ A Q+I  +L+ +
Sbjct:   76 GKVPSDIIAESLGIAKTLPPYLGSNLKPHDLLKGVIFASGGSGYDPLTSTLLSVVSMSDQLKYFQEYLAKIKQHFGEEKVKFILEKSVFLVVSSSNDLAETYWVRSV---EYDRNSYAEYLVELASEFIKELSELGAKNIGLFSGVPVGCLPAQRTLFGGFERKCYEKLNNMALHFNSKLSSSLDTLKKELPS-RLIFIDVYDTLLDIIKNPTNYGFKVADKGCCGTGKIELME-LCNKFTPFTCSDASTHVFFDSYHPSEKAYQIITHKLLAK 344          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL4_ARATH (GDSL esterase/lipase At1g20120 OS=Arabidopsis thaliana GN=At1g20120 PE=2 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 2.198e-46
Identity = 97/272 (35.66%), Postives = 148/272 (54.41%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            GK+ +DF AD +G K   PAYL P  T ++LL G +FAS GSGYD  T  +  AI +++QL Y++EY  K+    G +++  II   + IV AGS D    YY   L   +Y  + Y+S + +  +SF   +Y  GA+K G   + P+GC+P  RT  G  +  C   +N  AQ FN K+S++   L K + +  +V  DI+    D++Q+P K GF E  R             LCN  +   C N S ++FWDS HP++ A ++++ + +
Sbjct:  122 GKIPSDFIADYIGVKPVVPAYLRPGLTQEDLLTGVSFASGGSGYDPLTPIVVSAIPMSKQLTYFQEYIEKVKGFVGKEKAEHIISKGLAIVVAGSDDLANTYYGEHLEEFLYDIDTYTSFMASSAASFAMQLYESGAKKIGFIGVSPIGCIPIQRTTRGGLKRKCADELNFAAQLFNSKLSTSLNELAKTMKNTTLVYIDIYSSFNDMIQNPKKYGFDEIDRGCCGTGLLELGP-LCNKYTSLLCKNVSSFMFWDSYHPTERAYKILSQKFV 392          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL86_ARATH (GDSL esterase/lipase At5g45960 OS=Arabidopsis thaliana GN=At5g45960 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 3.749e-46
Identity = 101/266 (37.97%), Postives = 144/266 (54.14%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF---GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDL--KIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQ 783
            G+L TDF A  +G K   P YL P      L+ G +FASAGSGYD  T  + + I +  QL+Y+REY+ KL    G ++    I++A++ V AG+ DF+ NY+  P+  K +T E Y   +++    FI+ ++  GARK  V  LPP+GCLP   TLF         C+ R +T A  +N  +      +Q  L  L  KI   D++ P+Y++++ P K GF E               FLCNPKS   C N S YVF+DS+HPS+
Sbjct:   91 GRLVTDFIASYIGVKENVPPYLDPNLGINELISGVSFASAGSGYDPLTPTITNVIDIPTQLEYFREYKRKLEGKMGKQEMEKHIEEAMFCVSAGTNDFVINYFTIPIRRKTFTIEAYQQFVISNLKQFIQGLWKEGARKITVAGLPPIGCLPIVITLFSGEALTNRRCIDRFSTVATNYNFLLQKQLALMQVGLAHLGSKIFYLDVYNPVYEVIRDPRKFGFEEV-FSGCCGSGYLEASFLCNPKS-YVCPNTSAYVFFDSIHPSE 354          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EXL3_ARATH (GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana GN=EXL3 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 4.896e-46
Identity = 95/272 (34.93%), Postives = 146/272 (53.68%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++  D  A+ LG K+  PAYL P    K+LL G +FAS GSGYD  T  L   ISL  QL Y+ EY  K+  + G  +   I+ ++++++ AGS D    YY      + Y  + Y++++ +  S F+  +YG G R+  V   PP+GC+P+ RTL G     C    N  A+ FN K+S    +L+K LP +K +  +I+ P++D++Q+P+  GF E                LCN  +   C + S +VFWDS HP++   +V+   LI
Sbjct:   87 GRVPADLLAEELGIKSIVPAYLDPNLKSKDLLTGVSFASGGSGYDPITPKLVAVISLEDQLSYFEEYIEKVKNIVGEARKDFIVANSLFLLVAGSDDIANTYYTLRARPE-YDVDSYTTLMSDSASEFVTKLYGYGVRRVAVFGAPPIGCVPSQRTLGGGILRDCADNYNEAAKLFNSKLSPKLDSLRKTLPGIKPIYINIYDPLFDIIQNPANYGF-EVSNKGCCGTGAIEVAVLCNKITSSVCPDVSTHVFWDSYHPTEKTYKVLVSLLI 356          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL26_ARATH (GDSL esterase/lipase At1g59030/At1g59406 OS=Arabidopsis thaliana GN=At1g59030 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 3.174e-45
Identity = 99/273 (36.26%), Postives = 155/273 (56.78%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ LG     PAY++P    ++LL G  FAS G+GYD  T+ +   IS+  QL  ++EY SK+ +  G +++  I++ + ++V + S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+F G+   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K GF  A R            +LCN  +P TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:   74 GRVPSDLIAEKLGLAKTLPAYMNPYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQ---THRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYGFEVADR-GCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLL 341          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL25_ARATH (GDSL esterase/lipase At1g58725 OS=Arabidopsis thaliana GN=At1g58725 PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 3.174e-45
Identity = 99/273 (36.26%), Postives = 155/273 (56.78%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ LG     PAY++P    ++LL G  FAS G+GYD  T+ +   IS+  QL  ++EY SK+ +  G +++  I++ + ++V + S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+F G+   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K GF  A R            +LCN  +P TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:   74 GRVPSDLIAEKLGLAKTLPAYMNPYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQ---THRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYGFEVADR-GCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLL 341          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL1_ARATH (GDSL esterase/lipase At1g06990 OS=Arabidopsis thaliana GN=At1g06990 PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 3.174e-45
Identity = 96/281 (34.16%), Postives = 155/281 (55.16%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF--GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKL  DF A  +G K   P +L P  +  +++ G  FASAGSGYD+ T      +S+ +Q    R Y  +L+++ G +++ASI+ +A+ IV +G+ DF  N Y  P   +    + Y S +++   +F++ +Y +G RK  V  LPP+GCLP   T+     +E  C+ + N+D+Q+FN+K+ ++ T +Q  L    I   DI+  ++D+  +P + G  E  R            +LCN  +   C N +QY+FWD +HPSQ A  VI+  L+ Q F +L
Sbjct:   81 GKLIPDFIASLMGIKDTVPPFLDPHLSDSDIITGVCFASAGSGYDNLTDRATSTLSVDKQADMLRSYVERLSQIVGDEKAASIVSEALVIVSSGTNDFNLNLYDTPSRRQKLGVDGYQSFILSNVHNFVQELYDIGCRKIMVLGLPPVGCLPIQMTMAMQKQNERRCIDKQNSDSQEFNQKLKNSLTEMQSNLTGSVIFYGDIYGALFDMATNPQRYGLKETTR-GCCGTGEIELAYLCNALT-RICPNPNQYLFWDDIHPSQIAYIVISLSLVEQIFHVL 359          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL47_ARATH (GDSL esterase/lipase At2g40250 OS=Arabidopsis thaliana GN=At2g40250 PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 5.414e-45
Identity = 99/285 (34.74%), Postives = 153/285 (53.68%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG------YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 837
            GKLATDF   +LG K   PAYL+P     +LL G +FASAG G DDRT+  +  I++ +Q  Y+ E   K+  + G  ++  +IK+A++++ AG+ D + N Y + +L  + +   Y   L+     F++ +Y  GAR+  +  LPP+GCLP   TL        +H   C    N D++ +N+K+      L ++    K++  DI+ P+ D+++ P K G  E  R             LC P S  TC + S+Y+F+DSVHPSQ A  VIA   + + F LL
Sbjct:   80 GKLATDFIVSSLGLKPTLPAYLNPSVKPVDLLTGVSFASAGGGLDDRTAKSSLTITMDKQWSYFEEALGKMKSLVGDSETNRVIKNAVFVISAGTNDMIFNVY-DHVLGSLISVSDYQDSLLTKVEVFVQRLYEAGARRITIAGLPPIGCLPVQVTLTSINTPRIFHHRICTEHQNDDSRVYNQKLQKLIFGLSQRFRGSKVLYLDIYSPLIDMIKHPRKYGLEETLRGCCGTGLLEAGP-LCQPLS-RTCDDVSKYLFFDSVHPSQTAYSVIASFALQKLFPLL 361          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL23_ARATH (GDSL esterase/lipase At1g58430 OS=Arabidopsis thaliana GN=At1g58430 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.687e-44
Identity = 95/273 (34.80%), Postives = 151/273 (55.31%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVY-TPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            GK+ +D  A  L  K + P +L P  T + ++ G  FASAG+GYDD+TS    AI +++Q   ++ Y ++L  + G K++  II +A+ +V AG  DF+ NYY  P   ++Y +   Y   +++  ++F+K +Y LG RK  V  LPP+GCLP   T  F      C+ + N D+  +N+K+       Q  L   KI+  D++ P+ +++Q+PSK GF E  R            F+CN  S   C N S+++F+DS+HPS+A    I + L
Sbjct:   80 GKIFSDIIATKLNIKQFVPPFLQPNLTDQEIVTGVCFASAGAGYDDQTSLTTQAIRVSEQPNMFKSYIARLKSIVGDKKAMKIINNALVVVSAGPNDFILNYYEVPSWRRMYPSISDYQDFVLSRLNNFVKELYSLGCRKILVGGLPPMGCLPIQMTAQFRNVLRFCLEQENRDSVLYNQKLQKLLPQTQASLTGSKILYSDVYDPMMEMLQNPSKYGFKETTR-GCCGTGFLETSFMCNAYS-SMCQNRSEFLFFDSIHPSEATYNYIGNVL 350          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EXL1_ARATH (GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana GN=EXL1 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.687e-44
Identity = 97/273 (35.53%), Postives = 150/273 (54.95%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLN-HAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            GK+  D  A+ LG K   PAY +P    + LL G  FAS G+GY   T+ +    I L QQL Y+ EY  KL ++ G K++  IIK+++++V  GS D   +++  P +   YT   +++++ +   SF + +YG GAR+  V   PP+GC+P+ RT+ G     CV+R N  A+ FN K+S+    L + L D  I+  DI+ P+ DL+ +P + GF  A +             LCN  +   C   S YVFWDS HP++ A ++I  +L+
Sbjct:   96 GKVPGDIVAEELGIKPNIPAYRNPNLKPEELLTGVTFASGGAGYVPLTTKIAVGGIPLPQQLIYFEEYIEKLKQMVGEKRTKFIIKNSLFVVICGSNDIANDFFTLPPVRLHYTVASFTALMADNARSFAQTLYGYGARRILVFGAPPIGCVPSQRTVAGGPTRDCVARFNDAAKLFNTKLSANIDVLSRTLQDPTIIYIDIYSPLLDLILNPHQYGFKVANKGCCGTGLIEVTA-LCNNYTASVCPIRSDYVFWDSFHPTEKAYRIIVAKLL 367          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL52_ARATH2.198e-4636.50GDSL esterase/lipase At3g14820 OS=Arabidopsis thal... [more]
GDL4_ARATH2.198e-4635.66GDSL esterase/lipase At1g20120 OS=Arabidopsis thal... [more]
GDL86_ARATH3.749e-4637.97GDSL esterase/lipase At5g45960 OS=Arabidopsis thal... [more]
EXL3_ARATH4.896e-4634.93GDSL esterase/lipase EXL3 OS=Arabidopsis thaliana ... [more]
GDL26_ARATH3.174e-4536.26GDSL esterase/lipase At1g59030/At1g59406 OS=Arabid... [more]
GDL25_ARATH3.174e-4536.26GDSL esterase/lipase At1g58725 OS=Arabidopsis thal... [more]
GDL1_ARATH3.174e-4534.16GDSL esterase/lipase At1g06990 OS=Arabidopsis thal... [more]
GDL47_ARATH5.414e-4534.74GDSL esterase/lipase At2g40250 OS=Arabidopsis thal... [more]
GDL23_ARATH2.687e-4434.80GDSL esterase/lipase At1g58430 OS=Arabidopsis thal... [more]
EXL1_ARATH2.687e-4435.53GDSL esterase/lipase EXL1 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top