DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL44_ARATH (GDSL esterase/lipase At2g31550 OS=Arabidopsis thaliana GN=At2g31550 PE=2 SV=3)

HSP 1 Score: 177.948 bits (450), Expect = 7.817e-44
Identity = 96/273 (35.16%), Postives = 147/273 (53.85%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYT-PEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            GKL +D  A  L  K + P +L P  + +++L G  FASAG+GYDD TS    AI +++Q   ++ Y ++L  + G K++  II +A  +V AG  DF+ NYY  P     Y     Y   ++    +F++ +Y LG R   V  LPP+GCLP   T  F      C+   N D+  +N+K+      ++  LP  K +  D++ P+ +++Q+PSK GF E KR            F+CN  SP  C N S+++F+DS+HPS+A   VI + L
Sbjct:   80 GKLISDIIATKLNIKEFIPPFLQPNLSDQDILTGVCFASAGAGYDDLTSLSTQAIRVSEQPNMFKSYIARLKGIVGDKKAMEIINNAFVVVSAGPNDFILNYYDIPSRRLEYPFISGYQDFILKRLENFVRELYSLGVRNVLVGGLPPMGCLPIHMTAKFRNIFRFCLEHHNKDSVLYNEKLQKLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFKETKR-GCCGTGFLETSFMCNVFSP-VCQNRSEFMFFDSIHPSEATYNVIGNRL 350          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL42_ARATH (GDSL esterase/lipase At2g30310 OS=Arabidopsis thaliana GN=At2g30310 PE=2 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 7.817e-44
Identity = 93/271 (34.32%), Postives = 148/271 (54.61%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVY-TPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 807
            GK+ +D  A  L  K   P +L P  + ++++ G +FASAG+GYDDR+S  + AI ++QQ   ++ Y ++L  + G K++  II +A+ ++ AG  DF+ N+Y  P     Y T   Y   ++     F++ +Y LG R   V  LPP+GCLP   T         CV + N D+  +N+K+      +Q  LP    +  +++ P+ D++Q+PSK GF E K+            F+CNP +  TC N S ++FWDS+HPS+AA   I +
Sbjct:   79 GKVISDVIASKLNIKELVPPFLQPNISHQDIVTGVSFASAGAGYDDRSSLSSKAIPVSQQPSMFKNYIARLKGIVGDKKAMEIINNALVVISAGPNDFILNFYDIPTRRLEYPTIHGYQEFILKRLDGFVRELYSLGCRNIVVGGLPPMGCLPIQMTAKMRNILRFCVEQENKDSVLYNQKLVKKLPEIQASLPGSNFLYANVYDPLMDMIQNPSKYGFKETKK-GCCGTGYLETTFMCNPLTK-TCPNHSDHLFWDSIHPSEAAYNYIGN 347          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL43_ARATH (GDSL esterase/lipase At2g31540 OS=Arabidopsis thaliana GN=At2g31540 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.021e-43
Identity = 96/273 (35.16%), Postives = 148/273 (54.21%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYT-PEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 813
            GKL +D  A  L  K + P +L P  + +++L G  FASAG+GYDD TS    AI +++Q   ++ Y ++L  + G K++  II +A  +V AG  DF+ NYY  P     Y     Y   ++    +F++ +Y LG R   V  LPP+GCLP   T  F      C+   N D+  +N+K+ +    ++  LP  K +  D++ P+ +++Q+PSK GF E KR            F+CN  SP  C N S+++F+DS+HPS+A   VI + L
Sbjct:   80 GKLISDIIATKLNIKEFIPPFLQPNLSDQDILTGVCFASAGAGYDDLTSLSTQAIRVSEQPNMFKSYIARLKGIVGDKKAMEIINNAFVVVSAGPNDFILNYYEIPSRRLEYPFISGYQDFILKRLENFVRELYSLGVRNVLVGGLPPMGCLPIHMTAKFRNIFRFCLEHHNKDSVLYNEKLQNLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFKETKR-GCCGTGFLETSFMCNVFSP-VCQNRSEFLFFDSIHPSEATYNVIGNLL 350          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL41_ARATH (GDSL esterase/lipase At2g30220 OS=Arabidopsis thaliana GN=At2g30220 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.021e-43
Identity = 95/280 (33.93%), Postives = 153/280 (54.64%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVY-TPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLP-----AARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 822
            GKL +D  +  L  K + P +L P  + ++++ G  FASAG+GYDD TS  + AI ++QQ   ++ Y ++L  + G K++  II +A+ ++ AG  DF+ N+Y  P+    Y T   Y   ++     F++ +Y LG R   V  LPP+GCLP       RT+ G     CV + N D+  +N+K+      +Q  LP  K +  +++ P+ D++++PSK GF E K+            FLC   S  TC N S ++FWDS+HPS+AA + + + +  Q
Sbjct:   78 GKLISDVISTKLNIKEFVPPFLQPNISDQDIVTGVCFASAGAGYDDETSLSSKAIPVSQQPSMFKNYIARLKGIVGDKKAMEIINNALVVISAGPNDFILNFYDIPIRRLEYPTIYGYQDFVLKRLDGFVRELYSLGCRNILVGGLPPMGCLPIQLTAKLRTILGI----CVEQENKDSILYNQKLVKKLPEIQASLPGSKFLYANVYDPVMDMIRNPSKYGFKETKK-GCCGTGYLETSFLCTSLSK-TCPNHSDHLFWDSIHPSEAAYKYLGNFIDAQ 351          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL39_ARATH (GDSL esterase/lipase At2g24560 OS=Arabidopsis thaliana GN=At2g24560 PE=2 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 2.274e-43
Identity = 94/276 (34.06%), Postives = 151/276 (54.71%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTP-EQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 822
            GK+ +D  A  L  K + P +L P  + + ++ G  FASAG+GYDD TS    AI +  Q + ++ Y ++L  + G K++  IIK+A+ ++ AG  DF+ NYY  P     +     Y   ++    +F++ +Y LG RK  V  LPP+GCLP   T  F      C+ + N D+  +N+K+ +    ++  L   KI+  +++ P+ D++Q+PSK GF E KR            F+CN  SP TC N S+++F+DS+HPS+A    + + L  Q
Sbjct:   79 GKIFSDIIATKLNIKQFVPPFLQPNLSDQEIVTGVCFASAGAGYDDHTSLSTQAIRVLDQQKMFKNYIARLKSIVGDKKAMEIIKNALVVISAGPNDFILNYYDIPSRRLEFPHISGYQDFVLQRLDNFVRELYSLGCRKIMVGGLPPMGCLPIQMTAKFRNALRFCLEQENRDSVLYNQKLQNLLPQIEASLTGSKILYSNVYDPMMDMMQNPSKYGFKETKR-GCCGTGHLETSFMCNAFSP-TCRNHSEFLFFDSIHPSEATYNYMGNFLDTQ 352          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL24_ARATH (GDSL esterase/lipase At1g58480 OS=Arabidopsis thaliana GN=At1g58480 PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.274e-43
Identity = 96/273 (35.16%), Postives = 152/273 (55.68%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ LG     PAY++     ++LL G  FAS G+GYD  T+ +   IS+  QL Y++EY SK+ +  G +++  I++ + ++V + S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+F G+   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K G                  +LCN  +P TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:   74 GRVPSDLIAEKLGLAKTLPAYMNSYLKPEDLLKGVTFASRGTGYDPLTAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQA---HRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNEPLNNMAKQFNARLSPALDSLDKEL-DGVILYINVYDTLFDMIQHPKKYG--------CCGKGLLTISYLCNSLNPFTCSNSSSYIFWDSYHPSERAYQVIVDNLL 334          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL5_ARATH (GDSL esterase/lipase At1g23500 OS=Arabidopsis thaliana GN=At1g23500 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 8.643e-43
Identity = 100/273 (36.63%), Postives = 145/273 (53.11%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ L  K   PAY  P  +  +L  G  FAS GSG D+RT+     I +  Q++ ++EY  KL  V   K+  + II +A+Y++ AG+ D    Y   P L   YT   Y+ +LV    + +K++Y +GARKF V    PLGCLP AR   G   + C+  IN  A  FN+K+S+   NL   LP  K V  D++ P+ +L+ +P  SGF++                 C P SP  C +ASQYVFWD  HPS+ +   IA ++I
Sbjct:   79 GRVFSDMIAEGLNVKKLLPAYRDPNLSKNDLPTGVCFASGGSGLDERTARSQGVIWVPDQVKDFKEYIMKLNGVVRDKRKVNAIISNAVYLISAGNNDLAITY---PTLMAQYTVSTYTDLLVTWTDNLLKSLYAMGARKFAVLGTLPLGCLPGARHTGGNFGNICLVPINQVAAIFNQKLSAKLNNLHTILPGAKFVYVDMYNPLLNLINNPRASGFIDV-----------ADGCCCMPTSPVPCPDASQYVFWDFAHPSEKSYMTIAPKII 337          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL85_ARATH (GDSL esterase/lipase At5g45950 OS=Arabidopsis thaliana GN=At5g45950 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 4.289e-42
Identity = 99/272 (36.40%), Postives = 149/272 (54.78%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G LA D+ A+ +G+    PA+L P  T  +L  GA+FASAGSGYDD T+ +++  S T Q  Y+  Y+  L K+ G  +SA +I +AI+++  GS DFLQNY V+    K +T EQY   L +      K ++ LGA++  V  +PP+GC+P  + L G  +  CV ++N  A  FN K+      LQ ++  LK +  D +  I + +++P K GFVEA                   K    C + ++YVFWD+VHP+Q   Q+I  + I
Sbjct:   84 GLLAPDYIAEAMGYPPI-PAFLDPSLTQADLTRGASFASAGSGYDDLTANISNVWSFTTQANYFLHYKIHLTKLVGPLESAKMINNAIFLMSMGSNDFLQNYLVDFTRQKQFTVEQYIEFLSHRMLYDAKMLHRLGAKRLVVVGVPPMGCMPLIKYLRG--QKTCVDQLNQIAFSFNAKIIKNLELLQSKI-GLKTIYVDAYSTIQEAIKNPRKFGFVEASLGCCGTGTYEYGE---TCKDMQVCKDPTKYVFWDAVHPTQRMYQIIVKKAI 348          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: EXL2_ARATH (GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana GN=EXL2 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 4.015e-40
Identity = 89/281 (31.67%), Postives = 147/281 (52.31%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-------------YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            GK+ATDF A   G K   PAY +P    ++LL G  FAS G+GY   T+             +L   I+L+QQL+ + EY  K+ K+ G +++  IIK+++++V  GS D    Y+  P + + Y    +++++ +   SF + ++  GAR+  V   PP+GC+P+ RTL G     CV R N   + +N K+++   +L + L D  I+  DI+  + D++  P + GF    +             LCN  +   C N  +YVFWDS HP++   +++A
Sbjct:   92 GKVATDFIAGKFGIKPSIPAYRNPNLKPEDLLTGVTFASGGAGYVPFTTQLSTYLFIYKPLLFLKGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQQYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFNDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGFKVVDK-GCCGTGLIEVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMA 371          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL30_ARATH (GDSL esterase/lipase At1g73610 OS=Arabidopsis thaliana GN=At1g73610 PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 9.889e-39
Identity = 91/273 (33.33%), Postives = 140/273 (51.28%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++ +D  A+ LG K   PAY  P     +L  G  FAS GSG D  T+    +I ++ Q+  ++ Y ++L  V G+++ A+ +I +A+Y++ AG+ D    Y+        YT   Y+  LV+     IK++Y +GARKF V    PLGCLP AR L       C   +N  A  FN+++S+   NL    P  K V  D++ P+  L+ +P  SGF++                 C P     C +AS+YVFWD  HP+Q + + IA ++I
Sbjct:   79 GRVFSDIIAEGLGLKNLLPAYRDPYLWNNDLTTGVCFASGGSGLDPITARTTGSIWVSDQVTDFQNYITRLNGVVGNQEQANAVISNAVYLISAGNNDIAITYFTTGARRLQYTLPAYNDQLVSWTRDLIKSLYDMGARKFAVMGTLPLGCLPGARAL----TRACELFVNQGAAMFNQQLSADIDNLGATFPGAKFVYVDMYNPLLGLIINPQASGFIDV-----------ADACCCTPTHLIPCLDASRYVFWDVAHPTQKSYETIAPQII 336          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL44_ARATH7.817e-4435.16GDSL esterase/lipase At2g31550 OS=Arabidopsis thal... [more]
GDL42_ARATH7.817e-4434.32GDSL esterase/lipase At2g30310 OS=Arabidopsis thal... [more]
GDL43_ARATH1.021e-4335.16GDSL esterase/lipase At2g31540 OS=Arabidopsis thal... [more]
GDL41_ARATH1.021e-4333.93GDSL esterase/lipase At2g30220 OS=Arabidopsis thal... [more]
GDL39_ARATH2.274e-4334.06GDSL esterase/lipase At2g24560 OS=Arabidopsis thal... [more]
GDL24_ARATH2.274e-4335.16GDSL esterase/lipase At1g58480 OS=Arabidopsis thal... [more]
GDL5_ARATH8.643e-4336.63GDSL esterase/lipase At1g23500 OS=Arabidopsis thal... [more]
GDL85_ARATH4.289e-4236.40GDSL esterase/lipase At5g45950 OS=Arabidopsis thal... [more]
EXL2_ARATH4.015e-4031.67GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana ... [more]
GDL30_ARATH9.889e-3933.33GDSL esterase/lipase At1g73610 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top