DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL82_ARATH (GDSL esterase/lipase At5g45670 OS=Arabidopsis thaliana GN=At5g45670 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 4.604e-28
Identity = 81/271 (29.89%), Postives = 126/271 (46.49%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGAGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVI 801
            G    D  A  LGF+ Y   Y S  A G+++L G N+ASA +G  D T   L   I+   Q+  +    S++  + G +  AS  +   IY +G GS D+L NY++    +    ++PE Y+  LV  ++  ++ +Y  GARKF +  +  +GC P            C  RIN+  + FN K+ S      +  PD K    + +    D++ +P++ GF                   C P     C N ++YVFWD+ HP +AAN VI
Sbjct:   72 GLTTVDVIAQLLGFEDYITPYAS--ARGQDILRGVNYASAAAGIRDETGRQLGGRIAFAGQVANHVNTVSQVVNILGDQNEASNYLSKCIYSIGLGSNDYLNNYFMPTFYSTGNQFSPESYADDLVARYTEQLRVLYTNGARKFALIGVGAIGCSPNELAQNSRDGRTCDERINSANRIFNSKLISIVDAFNQNTPDAKFTYINAYGIFQDIITNPARYGF-RVTNAGCCGVGRNNGQITCLP-GQAPCLNRNEYVFWDAFHPGEAANIVI 338          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL31_ARATH (GDSL esterase/lipase At1g74460 OS=Arabidopsis thaliana GN=At1g74460 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.898e-27
Identity = 80/276 (28.99%), Postives = 135/276 (48.91%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLI-GANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNK--VYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+  +D   D +G      A+L P      +L  G N+AS G G  + T  Y     SL +Q++ ++  Q  +    G K++    +DA Y+V  GS DF+ NY + P+ +    Y  + +   L+    S +K ++ LGARK  V  L P+GC+P  R L    +  C ++ +  A++FNK  ++   +L+ +LP+      + +  + D++ +P K GF +                 C P S   C + S+YVFWD  HP+  AN+++A+ LI
Sbjct:   68 GRTVSDIIGDKIGLPRPV-AFLDPSMNEDVILENGVNYASGGGGILNETGGYFIQRFSLWKQIELFQGTQDVVVAKIGKKEADKFFQDARYVVALGSNDFINNYLM-PVYSDSWKYNDQTFVDYLMETLESQLKVLHSLGARKLMVFGLGPMGCIPLQRAL--SLDGNCQNKASNLAKRFNKAATTMLLDLETKLPNASYRFGEAYDLVNDVITNPKKYGF-DNSDSPCCSFYRIRPALTCIPAST-LCKDRSKYVFWDEYHPTDKANELVANILI 337          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GLIP5_ARATH (GDSL esterase/lipase 5 OS=Arabidopsis thaliana GN=GLIP5 PE=2 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 1.481e-26
Identity = 79/265 (29.81%), Postives = 128/265 (48.30%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCN----PKSPGTCSNASQYVFWDSVHPSQ 783
            G+L +DF A+        P +L P  + K L  G NFASAG+G    T +    I+L  QL +Y++ +       G ++S   I  A+Y++  GS D+   +  N  L    +  Q+  +++   ++FI  +Y +G RKFG  ++P LGC PA R L   ++  C+   +  A   N+ +++    +Q+Q+   K  +FD+ K +   +Q PSK GF E +             F C      K    C N   Y+FWDS+H +Q
Sbjct:   93 GRLISDFIAEYANLPLIPP-FLEPGNSQKKLY-GVNFASAGAGALVET-FQGSVINLRTQLDHYKKVERLWRTNFGKEESKKRISRAVYLISIGSNDYSSIFLTNQSLP--ISMSQHVDIVIGNLTTFIHEIYKIGGRKFGFLNVPDLGCFPALRILQPKNDDSCLRDASRLASMHNRALTNLLFQMQRQVKGFKFSLFDMNKSLRLRMQHPSKFGFKEGEE-ACCGTGKWRGVFSCGGKRIVKEYQLCENPKDYIFWDSLHLTQ 351          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL36_ARATH (GDSL esterase/lipase At2g19050 OS=Arabidopsis thaliana GN=At2g19050 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 9.600e-26
Identity = 79/271 (29.15%), Postives = 126/271 (46.49%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            G+   D  A+ + F  Y P +    A+ +   IG N+AS G G  + TS +L   IS  +Q++ +R      AKV   K     +   +Y +  GS D+L NY++    + NK ++ ++Y+  L+  + S++K++Y LGARK  V  +  LGC P      G   +GC + +N   + FNK + +      +   D K    DIF       QSP     +  +              LC    P  C    +YV+WD+VH ++AAN V+A
Sbjct:   74 GRNIPDIIAELMRFSDYIPPFTG--ASPEQAHIGINYASGGGGIREETSQHLGEIISFKKQIKNHRS-MIMTAKVPEEK-----LNKCLYTINIGSNDYLNNYFMPAPYMTNKKFSFDEYADSLIRSYRSYLKSLYVLGARKVAVFGVSKLGCTPRMIASHG-GGNGCAAEVNKAVEPFNKNLKALVYEFNRDFADAKFTFVDIFSG-----QSPFAFFMLGFRVTDKSCCTVKPGEELCATNEP-VCPVQRRYVYWDNVHSTEAANMVVA 329          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL29_ARATH (GDSL esterase/lipase At1g71691 OS=Arabidopsis thaliana GN=At1g71691 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.061e-24
Identity = 80/272 (29.41%), Postives = 125/272 (45.96%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGY-DDRTSYLNHAISLTQQLQYYREYQSKLA-KVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVN--PLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            G    D  A  LG     PAY   +ATG  +L G N+ASA +G   D        I   QQ+  +     ++A K  G+   A  +  +++ +G GS D+L NY +   P  N+ Y  +Q+  +LV  ++  +  +Y LG RKF V  L  +GC+P+   L   ++  C   +N     FN  V +  +NL + LPD K +  DI     D+V + +  G     +                 ++P  C N  QYVFWD+ HP++  N ++A
Sbjct:   98 GLTMVDGIAQLLGLPLI-PAY--SEATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQVASKSGGAVAIADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQ-YNSQQFGDLLVQHYTDQLTRLYNLGGRKFVVAGLGRMGCIPS--ILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETP--CPNRDQYVFWDAFHPTEKVNLIMA 361          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL28_ARATH (GDSL esterase/lipase At1g71250 OS=Arabidopsis thaliana GN=At1g71250 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 8.985e-24
Identity = 67/253 (26.48%), Postives = 118/253 (46.64%), Query Frame = 1
Query:   55 PAYLSPQATGKNLLIGANFASAGSGYDDRTSY-LNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKV--YTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            P +  P  +G  +L G N+ASA +G  D + Y      SL QQ+       S+L  +   +     +  ++ ++  GS D++ NY +  L +    + P  ++++L++ ++  +  +Y LG RK  +  + PLGC+P  R         CV  +N     FN+ + S    L ++ P    V  + +  I D++ +P+  GF    R                 ++P  C N +QYVFWD+ HP+Q AN ++A
Sbjct:  101 PPFADPTTSGNRILQGVNYASAAAGILDVSGYNYGGRFSLNQQMVNLETTLSQLRTMMSPQNFTDYLARSLVVLVFGSNDYINNYLMPNLYDSSIRFRPPDFANLLLSQYARQLLTLYSLGLRKIFIPGVAPLGCIPNQRARGISPPDRCVDSVNQILGTFNQGLKSLVDQLNQRSPGAIYVYGNTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPLQTP--CPNRNQYVFWDAFHPTQTANSILA 351          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL81_ARATH (GDSL esterase/lipase At5g41890 OS=Arabidopsis thaliana GN=At5g41890 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.002e-23
Identity = 74/284 (26.06%), Postives = 131/284 (46.13%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHA-ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLL-----NKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDL-VQSPSKSGFVEAKRXXXXXXXXXXXXFLC-----NPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+  +D   + LG K+  P YL P      +  G N+AS  +G  D T  L    + L +Q+  + + +  + +V G   +  ++K+A++ +  GS D L   Y+ P +     +K+ T     SM++++ ++ +K ++ LG RKF V  + PLGC+P AR L       C  ++N   + +N K+  +   L  +L         ++   YDL ++          K             F C        S   C + S++VFWD+ HP++AAN ++A  L+
Sbjct:   71 GRTISDIVGEALGAKSPPPPYLEPNTEANTIRNGINYASGAAGILDDTGLLFIGRVPLREQVSNFEKSREYMVRVIGENGTKEMLKNAMFTITIGSNDILN--YIQPSIPFFSQDKLPTDVLQDSMVLHL-TTHLKRLHQLGGRKFVVVGVGPLGCIPFARALNLIPAGKCSEQVNQVVRGYNMKLIHSLKTLNNELRSEDYNTTFVYANSYDLFLKLVLNYQLFGLKNADKPCCGGYFPPFACFKGPNQNSSQAACEDRSKFVFWDAYHPTEAANLIVAKALL 351          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL17_ARATH (GDSL esterase/lipase At1g33811 OS=Arabidopsis thaliana GN=At1g33811 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.002e-23
Identity = 77/277 (27.80%), Postives = 124/277 (44.77%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKV--AGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKV--YTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG---CVSRINTDAQQFNKKVSSAATNLQK-QLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            G+   D  A  LGF+ Y P Y   +  G+ +L GANFAS  +G  D T   L    S+ QQ++ Y     ++ +     + +    +   I+  G GS D+L NY++    +    Y  + ++  L+  ++  +  +Y  GARK  VT +  +GC+P     +    +    C  +IN     FN +V      L K QL   K V  D +K  YDL  + +  GF E                 C P     C + ++Y+FWD+ HP++ AN ++A
Sbjct:   77 GRTYVDALAQILGFRNYIPPY--SRIRGQAILRGANFASGAAGIRDETGDNLGAHTSMNQQVELYTTAVQQMLRYFRGDTNELQRYLSRCIFYSGMGSNDYLNNYFMPDFYSTSTNYNDKTFAESLIKNYTQQLTRLYQFGARKVIVTGVGQIGCIPYQLARYNNRNNSTGRCNEKINNAIVVFNTQVKKLVDRLNKGQLKGAKFVYLDSYKSTYDLAVNGAAYGF-EVVDKGCCGVGRNNGQITCLPLQT-PCPDRTKYLFWDAFHPTETANILLA 349          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL75_ARATH (GDSL esterase/lipase At5g08460 OS=Arabidopsis thaliana GN=At5g08460 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.824e-23
Identity = 70/274 (25.55%), Postives = 126/274 (45.99%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLL--NKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIF---DIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 804
            GK   DF  + LG     PA++     G ++L G N+ASA  G  + T  +L    S+ +Q++ + +   ++++    +     +  ++ +V  G+ D++ NY    L   + +Y P  ++ +L++ F++ +  +YG G RKF +  + PLGC+P            CV  +N  A+ FN ++ S    L          IF   + +    D++ +P   GF E                 C P +   C+   ++VFWD+ HP+QA N +IA
Sbjct:   93 GKTIVDFIGELLGLPEI-PAFMDTVDGGVDILHGVNYASAAGGILEETGRHLGERFSMGRQVENFEKTLMEISRSMRKESVKEYMAKSLVVVSLGNNDYINNYLKPRLFLSSSIYDPTSFADLLLSNFTTHLLELYGKGFRKFVIAGVGPLGCIPDQLAAQAALPGECVEAVNEMAELFNNRLVSLVDRLNSDNKTASEAIFVYGNTYGAAVDILTNPFNYGF-EVTDRGCCGVGRNRGEITCLPLAV-PCAFRDRHVFWDAFHPTQAFNLIIA 363          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL37_ARATH (GDSL esterase/lipase At2g19060 OS=Arabidopsis thaliana GN=At2g19060 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 6.439e-22
Identity = 75/272 (27.57%), Postives = 126/272 (46.32%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS-YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQK--QLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVI 801
            G+   DF A+ L      P +   +A+ +    G N+AS G+G  + TS +L   IS  +Q+  +R    K+   AG       +K  +Y +  GS D+L NY++      N+ ++ ++Y+  L+  + S++K++Y LGARK  V  +  LGC P      G    GC + +N   + FNKK+    +   +   +   K    D+F       Q+P +   +                 LC    P  C N  +YV+WD+VH ++AAN+V+
Sbjct:   73 GRNIPDFIAEELRISYDIPPFT--RASTEQAHTGINYASGGAGLLEETSQHLGERISFEKQITNHR----KMIMTAGVPPEK--LKKCLYTINIGSNDYLNNYFMPAPYTTNENFSFDEYADFLIQSYRSYLKSLYVLGARKVAVFGVSKLGCTPRMIASHG-GGKGCATEVNKAVEPFNKKLKDLISEFNRISVVDHAKFTFVDLFSS-----QNPIEYFILGFTVTDKSCCTVESGQELCAANKP-VCPNRERYVYWDNVHSTEAANKVV 329          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GDL82_ARATH4.604e-2829.89GDSL esterase/lipase At5g45670 OS=Arabidopsis thal... [more]
GDL31_ARATH3.898e-2728.99GDSL esterase/lipase At1g74460 OS=Arabidopsis thal... [more]
GLIP5_ARATH1.481e-2629.81GDSL esterase/lipase 5 OS=Arabidopsis thaliana GN=... [more]
GDL36_ARATH9.600e-2629.15GDSL esterase/lipase At2g19050 OS=Arabidopsis thal... [more]
GDL29_ARATH1.061e-2429.41GDSL esterase/lipase At1g71691 OS=Arabidopsis thal... [more]
GDL28_ARATH8.985e-2426.48GDSL esterase/lipase At1g71250 OS=Arabidopsis thal... [more]
GDL81_ARATH2.002e-2326.06GDSL esterase/lipase At5g41890 OS=Arabidopsis thal... [more]
GDL17_ARATH2.002e-2327.80GDSL esterase/lipase At1g33811 OS=Arabidopsis thal... [more]
GDL75_ARATH5.824e-2325.55GDSL esterase/lipase At5g08460 OS=Arabidopsis thal... [more]
GDL37_ARATH6.439e-2227.57GDSL esterase/lipase At2g19060 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top