DC899996

Overview
NameDC899996
Unique NameDC899996
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length996
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:292..1287. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GRIP4_ARATH (GDSL esterase/lipase 4 OS=Arabidopsis thaliana GN=GLIP4 PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.874e-21
Identity = 73/282 (25.89%), Postives = 119/282 (42.20%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRT---SYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPG----TCSNASQYVFWDSVHPSQAANQVIADELIVQG 825
            G++  DF A+   +    P  L P  +   L  G NFA+  +G    T   S  N +  L  QL  ++  +  L    G  ++  +I  A+Y+   G+ D+   ++ N       T E++   ++   ++ I+ +Y LGARKFG  SL P GC P+A  +       C   +       N++       L+++L   K  + D    +   + +PS+ GF E +                    P      C NA  YVF+D  H ++ A+Q IA ELI  G
Sbjct:   82 GRIMIDFIAE-YAWLPLIPPNLQPGYSNSQLTYGLNFATTAAGVFAGTFPGSVTNLSKDLGTQLNNFKNVEKTLRSNLGDAEARRVISKAVYLFHIGANDYQYPFFANTSTFSNTTKERFIDFVIGNTTTVIEELYKLGARKFGFLSLGPFGCTPSALIINSTKIGSCFEPVTELINLHNQEFPKVLRRLERRLSGFKYALHDFHTSLSQRINNPSRYGFKEGEMACCGSGPLRGINTCGFRNGPSQGYKLCENADDYVFFDPSHLTETAHQQIA-ELIWSG 361          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GLIP3_ARATH (GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=GLIP3 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 2.447e-21
Identity = 69/261 (26.44%), Postives = 112/261 (42.91%), Query Frame = 1
Query:   55 PAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSP----GTCSNASQYVFWDSVHPSQAANQVIADELIVQG 825
            P  L P         G +FASAG+G     S+L   I+L  QL  +++ +  L    G  ++  +   A+Y+   G+ D+   +  N    K  + E++   ++   +  I+ +Y +G RKFG  ++ P  C P +          C   +       NKK       LQ+QL   +  + D    + + + SPSK GF E K+               N   P    G C N + Y+F+DS H ++ A++ IA ELI  G
Sbjct:   90 PPNLQPNNGNNQFTYGVSFASAGAGALAE-SFLGMVINLGTQLNNFKDVEKSLRSELGDAETKRVFSRAVYLFHIGANDYFYPFSANSSTFKSNSKEKFVDFVIGNITFVIEEVYKMGGRKFGFLNVGPYECSPNSLIRDRTKIGSCFKPVAELIDMHNKKFPDVLRRLQRQLSGFRYALHDYHTSLSERINSPSKYGFKEGKKACCGSGPLRGINTCGNRIGPSQGYGLCENVTDYLFYDSSHLTEKAHRQIA-ELIWNG 348          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GLIP1_ARATH (GDSL esterase/lipase 1 OS=Arabidopsis thaliana GN=GLIP1 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.586e-20
Identity = 74/280 (26.43%), Postives = 117/280 (41.79%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCN-----PKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQG 825
            G+L  DF A+   +    P  L P         G NFAS G+G    T +    I+L  QL  +++ +  L    G  +   +I  A+Y+   G  D+   +  N  L +  + E+Y   +V   +   K +Y LG RKFG+ +  P  C PA+  +       C   +       N+K+ +    L  +L   K  + D    + + +  PSK GF E K+              C       +S   C N + Y+F+D  H ++ AN+ IA ELI  G
Sbjct:   82 GRLIPDFIAE-YAWLPLIPPNLQPFNGNSQFAYGVNFASGGAGALVGT-FSGLVINLRTQLNNFKKVEEMLRSKLGDAEGKRVISRAVYLFHIGLNDYQYPFTTNSSLFQSISNEKYVDYVVGNMTDVFKEVYNLGGRKFGILNTGPYDCAPASLVIDQTKIRSCFQPVTELINMHNEKLLNGLRRLNHELSGFKYALHDYHTSLSERMNDPSKYGFKEGKKACCGSGPLRGIN-TCGGRMGLSQSYELCENVTDYLFFDPFHLTEKANRQIA-ELIWSG 357          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL76_ARATH (GDSL esterase/lipase At5g14450 OS=Arabidopsis thaliana GN=At5g14450 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.586e-20
Identity = 82/300 (27.33%), Postives = 127/300 (42.33%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTS----YLNHAISLTQQLQYYREYQSKLAKVAGSKQSA---------SIIKDAIYIVGAGSGDFLQNYYVNPLLN-KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG------YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSP--------GTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF A+ LG   Y  AYL+  + G N   GANFA+ GS    +      Y     SL  Q+  + +++++ A +    +S               A+Y    G  D    +    +   K   P+     +VN  +S ++N+Y  G R F V +  P GCLP      G        +SGCV   N  A +FN+K+     NL+K+L    I   D++   Y+++ +P K GF    +            + C  K          G+C N    V WD VH ++AAN+ +AD  +
Sbjct:   81 GRLTIDFIAERLGLP-YLSAYLN--SLGSNFRHGANFATGGSTIRRQNETIFQYGISPFSLDMQIAQFDQFKARSALLFTQIKSRYDREKLPRQEEFAKALYTFDIGQNDLSVGFRTMSVDQLKATIPD-----IVNHLASAVRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLKETVINLRKELTQAAITYVDVYTAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIW-CGNKGKVNNTEIYGGSCPNPVMAVSWDGVHYTEAANKHVADRTL 371          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL68_ARATH (GDSL esterase/lipase At4g30140 OS=Arabidopsis thaliana GN=At4g30140 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.533e-20
Identity = 67/272 (24.63%), Postives = 120/272 (44.12%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSY-LNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 807
            G+   D  A+  GF    P +        N  IG N+AS   G  + TS  +   ISL QQ+  +       + +  +    S ++  +Y +  GS D+L NY+++P  L  +++ P+QY+  L++++  ++  +Y LGAR   +  +  +GC P      G   +GC   +N     FN K+ +  T+   + P       D+F       +  +  G     R             LC    P  C + ++++FWD+VH ++  N V+A+
Sbjct:   76 GRNIPDVIAELAGFNNPIPPFAGASQAQAN--IGLNYASGAGGIREETSENMGERISLRQQVNNH------FSAIITAAVPLSRLRQCLYTINIGSNDYLNNYFLSPPTLARRLFNPDQYARSLISLYRIYLTQLYVLGARNVALFGIGKIGCTPRIVATLG-GGTGCAEEVNQAVIIFNTKLKALVTDFNNK-PGAMFTYVDLFS---GNAEDFAALGITVGDRSCCTVNPGEE---LCAANGP-VCPDRNKFIFWDNVHTTEVINTVVAN 330          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL10_ARATH (GDSL esterase/lipase At1g28610 OS=Arabidopsis thaliana GN=At1g28610 PE=2 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 7.872e-20
Identity = 87/291 (29.90%), Postives = 130/291 (44.67%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAG------SGYDDRTSYLNHA-ISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G++  DF A+ LG     P Y S      N   G NFA AG      S  + R  Y  H+ ISL  QL+ ++E    L  + GS      +I +A  I+G  G  DF   ++VN    K    ++   +++   SS I  +  +G R F V    PLGC     TL+           +GC++ +N  ++ +N+K+ +    L K  P + I+  D F  +  L Q PSK GF++                L   C       CS+ S+YV WD VH ++AA + IAD L+
Sbjct:   77 GRIIIDFIAEFLGLPHVPPFYGSKNG---NFEKGVNFAVAGATALETSILEKRGIYYPHSNISLGIQLKTFKE---SLPNLCGSPTDCRDMIGNAFIIMGEIGGNDFNFAFFVN----KTSEVKELVPLVITKISSAIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEEYDPLTGCLTWLNDFSEYYNEKLQAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFMDRPLPACCGLGGPYNFTLSKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLL 357          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GLIP2_ARATH (GDSL esterase/lipase 2 OS=Arabidopsis thaliana GN=GLIP2 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.907e-19
Identity = 77/281 (27.40%), Postives = 122/281 (43.42%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLL-IGANFASAGSGYDDRTSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFLCN-----PKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQG 825
            G+   DF A+   +    PAYL P + GKN    G +FASAG+G    T +    I+L  QL  +++ +  L    G  Q   +I  A+Y+   G  D+   +  N  + +    E Y   +V   ++ IK +Y +G RKFG  ++    C PA+  +       C   +       N+K+ S    L+++L   K  + D    +   + +PSK GF E K               C       +S   C   + Y+F+D  H ++ A+Q IA ELI  G
Sbjct:   84 GRTIPDFIAE-YAWLPLIPAYLQP-SNGKNQFPYGVSFASAGAGALVGT-FPGMVINLKSQLNNFKKVEKLLRSTLGEAQGKMVISRAVYLFHIGVNDYQYPFSTNSSIFQSSPQEIYVDFVVGNTTAVIKEVYKIGGRKFGFLNMGAYDCAPASLIIDQTKIGTCFKPVTELINLHNEKLESGLRRLERELSGFKYALHDYHTSLSVRMNNPSKYGFKEGKMACCGTGPLRGIN-TCGGRMGVSQSYELCEKVTDYLFFDHFHLTEKAHQQIA-ELIWSG 359          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL91_ARATH (GDSL esterase/lipase At1g28640 OS=Arabidopsis thaliana GN=At1g28640 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.907e-19
Identity = 75/290 (25.86%), Postives = 130/290 (44.83%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAI-------SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGY-----HE--SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF A+ LG   Y P+Y   Q    +   G NFA  G+   DR   +   I       SL+ QL  +++    L   + S+    ++ D++ ++G  G  D+   ++    +N++   +Q   +++   SS I ++  LG + F V    PLGC PA  TLF       H+  +GC+ R+N   +  N+++ +    LQ+    + I+  D +  ++ L Q P K GF                  +   C  +    C N S+YV WD  H ++A +Q +A  ++
Sbjct:   81 GRLIIDFIAEFLGLP-YVPSYFGSQNVSFDQ--GINFAVYGATALDRVFLVGKGIESDFTNVSLSVQLNIFKQILPNLC-TSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGKSINEI---KQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEEDHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGFKNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVIL 363          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL2_ARATH (GDSL esterase/lipase At1g09390 OS=Arabidopsis thaliana GN=At1g09390 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.907e-19
Identity = 73/286 (25.52%), Postives = 131/286 (45.80%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAISLT-QQLQYYREYQSKLAKVAGSKQSASI----IKDAIYIVGAGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFS---SFIKNMYGLGARKFGVTSLPPLGCLPAARTLF---GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF---VEAKRXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF   +L      P YL     G     GANFA  GS    R  Y+  A+++   Q  +++    +LA ++   +   I     ++A+Y++  G  D   ++      +K  +  +   ++ N+ S   S IK +Y  G RKF V +  PLGCLP   ++    G+ + GC++  N  A+ FN+ +     +L+ +L +  IV  DI+   YDL+ + +  GF   + A                C      +C   S+++ WD +H ++ AN ++A +++
Sbjct:   78 GRLVIDFLCQSLNTSLLNP-YLD-SLVGSKFQNGANFAIVGSSTLPR--YVPFALNIQLMQFLHFKSRALELASISDPLKEMMIGESGFRNALYMIDIGQNDIADSF------SKGLSYSRVVKLIPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVHSKGFDKHGCLATYNAAAKLFNEGLDHMCRDLRTELKEANIVYVDIYAIKYDLIANSNNYGFEKPLMACCGYGGPPYNYNVNITCGNGGSKSCDEGSRFISWDGIHYTETANAIVAMKVL 353          
BLAST of DC899996 vs. ExPASy Swiss-Prot
Match: GDL11_ARATH (GDSL esterase/lipase At1g28650 OS=Arabidopsis thaliana GN=At1g28650 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.664e-19
Identity = 75/289 (25.95%), Postives = 126/289 (43.60%), Query Frame = 1
Query:    1 GKLATDFTADTLGFKTYAPAYLSPQATGKNLLIGANFASAGSGYDDRTSYLNHAI-------SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGA-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGY----HE--SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAKRXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 816
            G+L  DF A+ LG   Y P Y   Q    N   G NFA  G+   DR   +   I       SL+ QL  +++    L   + ++    ++ D++ ++G  G  D+   ++    +N++   ++   +++   SS I ++  LG + F V    P+GC  A  TLF      H+  +GC+  +N   +  N+++      LQK  P + I+  D +  +Y L Q P+K GF                  +   C       C N S+YV WD  H ++A  Q +A  L+
Sbjct:   83 GRLVIDFIAEFLGLP-YVPPYFGSQNVSFNQ--GINFAVYGATALDRAFLVKQGIKSDFTNISLSVQLNTFKQILPNLC-ASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEI---KELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATVEHDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLL 364          
The following BLAST results are available for this feature:
BLAST of DC899996 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 96
Match NameE-valueIdentityDescription
GRIP4_ARATH1.874e-2125.89GDSL esterase/lipase 4 OS=Arabidopsis thaliana GN=... [more]
GLIP3_ARATH2.447e-2126.44GDSL esterase/lipase 3 OS=Arabidopsis thaliana GN=... [more]
GLIP1_ARATH1.586e-2026.43GDSL esterase/lipase 1 OS=Arabidopsis thaliana GN=... [more]
GDL76_ARATH1.586e-2027.33GDSL esterase/lipase At5g14450 OS=Arabidopsis thal... [more]
GDL68_ARATH3.533e-2024.63GDSL esterase/lipase At4g30140 OS=Arabidopsis thal... [more]
GDL10_ARATH7.872e-2029.90GDSL esterase/lipase At1g28610 OS=Arabidopsis thal... [more]
GLIP2_ARATH3.907e-1927.40GDSL esterase/lipase 2 OS=Arabidopsis thaliana GN=... [more]
GDL91_ARATH3.907e-1925.86GDSL esterase/lipase At1g28640 OS=Arabidopsis thal... [more]
GDL2_ARATH3.907e-1925.52GDSL esterase/lipase At1g09390 OS=Arabidopsis thal... [more]
GDL11_ARATH6.664e-1925.95GDSL esterase/lipase At1g28650 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899996 VSS Citrus sinensis cDNA clone VS27Q07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899996 ID=DC899996|Name=DC899996|organism=Citrus sinensis|type=EST|length=996bp
GGGAAATTAGCCACTGACTTCACTGCTGATACCCTAGGCTTTAAGACTTA
TGCGCCAGCATATCTCAGTCCACAGGCTACAGGGAAAAACCTCCTTATTG
GAGCCAACTTTGCTTCAGCGGGATCTGGTTATGATGACAGGACATCCTAC
TTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTACTATAGAGAGTA
CCAGAGTAAGCTAGCAAAGGTAGCTGGTAGCAAACAATCAGCTTCCATAA
TCAAGGATGCGATATACATAGTGGGTGCTGGGAGTGGTGACTTTCTTCAG
AATTACTATGTCAATCCTTTACTTAACAAAGTCTACACTCCTGAGCAGTA
TAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAAGAACATGTATG
GATTGGGAGCAAGAAAATTTGGAGTGACTTCACTGCCACCATTGGGTTGC
CTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGTGGCTGTGTCTC
TAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGTCAGCTCCGCAG
CAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTGTGATTTTCGAC
ATTTTCAAGCCAATCTATGACCTTGTCCAATCCCCTTCAAAATCTGGCTT
CGTGGAGGCAAAAAGAGGTTGCTGTGGAACAGGAACTGTAGAAACAACTG
TCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCAATGCCTCTCAG
TATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCTAATCAGGTTAT
TGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTGAAGGGGATGTC
AAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCTTAATCTTCTTG
GTGTCTGTGCTTCAGTTTATCTGCTTGTCTATACATCATTTTAAGATTTC
CTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTTTTGCTAC
back to top