DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL23_ARATH (GDSL esterase/lipase At1g58430 OS=Arabidopsis thaliana GN=At1g58430 PE=2 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 1.327e-30
Identity = 73/226 (32.30%), Postives = 121/226 (53.54%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVY-TPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 674
            TS    AI +++Q   ++ Y ++L  + G K++  II +A+ +V +G  DF+ NYY  P   ++Y +   Y   +++  ++F+K +Y LG RK  V  LPP+GCLP   T  F      C+ + N D+  +N+K+       Q  L   KI+  D++ P+ +++Q+PSK GF E               F+CN  S   C N S+++F+DS+HPS+A    I + L
Sbjct:  127 TSLTTQAIRVSEQPNMFKSYIARLKSIVGDKKAMKIINNALVVVSAGPNDFILNYYEVPSWRRMYPSISDYQDFVLSRLNNFVKELYSLGCRKILVGGLPPMGCLPIQMTAQFRNVLRFCLEQENRDSVLYNQKLQKLLPQTQASLTGSKILYSDVYDPMMEMLQNPSKYGFKET-TRGCCGTGFLETSFMCNAYS-SMCQNRSEFLFFDSIHPSEATYNYIGNVL 350          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EXL2_ARATH (GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana GN=EXL2 PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.263e-30
Identity = 66/219 (30.14%), Postives = 118/219 (53.88%), Query Frame = 3
Query:    9 YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            +L   I+L+QQL+ + EY  K+ K+ G +++  IIK+++++V  GS D    Y+  P + + Y    +++++ +   SF + ++  GAR+  V   PP+GC+P+ RTL G     CV R N   + +N K+++   +L + L D  I+  DI+  + D++  P + GF +                LCN  +   C N  +YVFWDS HP++   +++A
Sbjct:  154 FLKGGIALSQQLKLFEEYVEKMKKMVGEERTKLIIKNSLFMVICGSNDITNTYFGLPSVQQQYDVASFTTLMADNARSFAQKLHEYGARRIQVFGAPPVGCVPSQRTLAGGPTRNCVVRFNDATKLYNVKLAANLGSLSRTLGDKTIIYVDIYDSLLDIILDPRQYGF-KVVDKGCCGTGLIEVALLCNNFAADVCPNRDEYVFWDSFHPTEKTYRIMA 371          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL41_ARATH (GDSL esterase/lipase At2g30220 OS=Arabidopsis thaliana GN=At2g30220 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.956e-30
Identity = 74/233 (31.76%), Postives = 122/233 (52.36%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVY-TPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLP-----AARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 683
            TS  + AI ++QQ   ++ Y ++L  + G K++  II +A+ ++ +G  DF+ N+Y  P+    Y T   Y   ++     F++ +Y LG R   V  LPP+GCLP       RT+ G     CV + N D+  +N+K+      +Q  LP  K +  +++ P+ D++++PSK GF E               FLC   S  TC N S ++FWDS+HPS+AA + + + +  Q
Sbjct:  125 TSLSSKAIPVSQQPSMFKNYIARLKGIVGDKKAMEIINNALVVISAGPNDFILNFYDIPIRRLEYPTIYGYQDFVLKRLDGFVRELYSLGCRNILVGGLPPMGCLPIQLTAKLRTILGI----CVEQENKDSILYNQKLVKKLPEIQASLPGSKFLYANVYDPVMDMIRNPSKYGFKET-KKGCCGTGYLETSFLCTSLSK-TCPNHSDHLFWDSIHPSEAAYKYLGNFIDAQ 351          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL42_ARATH (GDSL esterase/lipase At2g30310 OS=Arabidopsis thaliana GN=At2g30310 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 8.599e-30
Identity = 71/224 (31.70%), Postives = 117/224 (52.23%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVY-TPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG-CVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 668
            +S  + AI ++QQ   ++ Y ++L  + G K++  II +A+ ++ +G  DF+ N+Y  P     Y T   Y   ++     F++ +Y LG R   V  LPP+GCLP   T    +    CV + N D+  +N+K+      +Q  LP    +  +++ P+ D++Q+PSK GF E               F+CNP +  TC N S ++FWDS+HPS+AA   I +
Sbjct:  126 SSLSSKAIPVSQQPSMFKNYIARLKGIVGDKKAMEIINNALVVISAGPNDFILNFYDIPTRRLEYPTIHGYQEFILKRLDGFVRELYSLGCRNIVVGGLPPMGCLPIQMTAKMRNILRFCVEQENKDSVLYNQKLVKKLPEIQASLPGSNFLYANVYDPLMDMIQNPSKYGFKET-KKGCCGTGYLETTFMCNPLTK-TCPNHSDHLFWDSIHPSEAAYNYIGN 347          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL44_ARATH (GDSL esterase/lipase At2g31550 OS=Arabidopsis thaliana GN=At2g31550 PE=2 SV=3)

HSP 1 Score: 130.183 bits (326), Expect = 1.467e-29
Identity = 72/226 (31.86%), Postives = 116/226 (51.33%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYT-PEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 674
            TS    AI +++Q   ++ Y ++L  + G K++  II +A  +V +G  DF+ NYY  P     Y     Y   ++    +F++ +Y LG R   V  LPP+GCLP   T  F      C+   N D+  +N+K+      ++  LP  K +  D++ P+ +++Q+PSK GF E               F+CN  SP  C N S+++F+DS+HPS+A   VI + L
Sbjct:  127 TSLSTQAIRVSEQPNMFKSYIARLKGIVGDKKAMEIINNAFVVVSAGPNDFILNYYDIPSRRLEYPFISGYQDFILKRLENFVRELYSLGVRNVLVGGLPPMGCLPIHMTAKFRNIFRFCLEHHNKDSVLYNEKLQKLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFKET-KRGCCGTGFLETSFMCNVFSP-VCQNRSEFMFFDSIHPSEATYNVIGNRL 350          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL39_ARATH (GDSL esterase/lipase At2g24560 OS=Arabidopsis thaliana GN=At2g24560 PE=2 SV=2)

HSP 1 Score: 130.183 bits (326), Expect = 1.467e-29
Identity = 72/229 (31.44%), Postives = 121/229 (52.84%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTP-EQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 683
            TS    AI +  Q + ++ Y ++L  + G K++  IIK+A+ ++ +G  DF+ NYY  P     +     Y   ++    +F++ +Y LG RK  V  LPP+GCLP   T  F      C+ + N D+  +N+K+ +    ++  L   KI+  +++ P+ D++Q+PSK GF E               F+CN  SP TC N S+++F+DS+HPS+A    + + L  Q
Sbjct:  126 TSLSTQAIRVLDQQKMFKNYIARLKSIVGDKKAMEIIKNALVVISAGPNDFILNYYDIPSRRLEFPHISGYQDFVLQRLDNFVRELYSLGCRKIMVGGLPPMGCLPIQMTAKFRNALRFCLEQENRDSVLYNQKLQNLLPQIEASLTGSKILYSNVYDPMMDMMQNPSKYGFKET-KRGCCGTGHLETSFMCNAFSP-TCRNHSEFLFFDSIHPSEATYNYMGNFLDTQ 352          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL85_ARATH (GDSL esterase/lipase At5g45950 OS=Arabidopsis thaliana GN=At5g45950 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.916e-29
Identity = 75/225 (33.33%), Postives = 118/225 (52.44%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ +++  S T Q  Y+  Y+  L K+ G  +SA +I +AI+++  GS DFLQNY V+    K +T EQY   L +      K ++ LGA++  V  +PP+GC+P  + L G  +  CV ++N  A  FN K+      LQ ++  LK +  D +  I + +++P K GFVEA                   K    C + ++YVFWD+VHP+Q   Q+I  + I
Sbjct:  130 TANISNVWSFTTQANYFLHYKIHLTKLVGPLESAKMINNAIFLMSMGSNDFLQNYLVDFTRQKQFTVEQYIEFLSHRMLYDAKMLHRLGAKRLVVVGVPPMGCMPLIKYLRG--QKTCVDQLNQIAFSFNAKIIKNLELLQSKI-GLKTIYVDAYSTIQEAIKNPRKFGFVEASLGCCGTGTYEYGE---TCKDMQVCKDPTKYVFWDAVHPTQRMYQIIVKKAI 348          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL43_ARATH (GDSL esterase/lipase At2g31540 OS=Arabidopsis thaliana GN=At2g31540 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.916e-29
Identity = 72/226 (31.86%), Postives = 117/226 (51.77%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYT-PEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTL-FGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 674
            TS    AI +++Q   ++ Y ++L  + G K++  II +A  +V +G  DF+ NYY  P     Y     Y   ++    +F++ +Y LG R   V  LPP+GCLP   T  F      C+   N D+  +N+K+ +    ++  LP  K +  D++ P+ +++Q+PSK GF E               F+CN  SP  C N S+++F+DS+HPS+A   VI + L
Sbjct:  127 TSLSTQAIRVSEQPNMFKSYIARLKGIVGDKKAMEIINNAFVVVSAGPNDFILNYYEIPSRRLEYPFISGYQDFILKRLENFVRELYSLGVRNVLVGGLPPMGCLPIHMTAKFRNIFRFCLEHHNKDSVLYNEKLQNLLPQIEASLPGSKFLYADVYNPMMEMIQNPSKYGFKET-KRGCCGTGFLETSFMCNVFSP-VCQNRSEFLFFDSIHPSEATYNVIGNLL 350          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL47_ARATH (GDSL esterase/lipase At2g40250 OS=Arabidopsis thaliana GN=At2g40250 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 9.508e-29
Identity = 69/231 (29.87%), Postives = 118/231 (51.08%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG------YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFALL 698
            I++ +Q  Y+ E   K+  + G  ++  +IK+A++++ +G+ D + N Y + +L  + +   Y   L+     F++ +Y  GAR+  +  LPP+GCLP   TL        +H   C    N D++ +N+K+      L ++    K++  DI+ P+ D+++ P K G  E                LC P S  TC + S+Y+F+DSVHPSQ A  VIA   + + F LL
Sbjct:  134 ITMDKQWSYFEEALGKMKSLVGDSETNRVIKNAVFVISAGTNDMIFNVY-DHVLGSLISVSDYQDSLLTKVEVFVQRLYEAGARRITIAGLPPIGCLPVQVTLTSINTPRIFHHRICTEHQNDDSRVYNQKLQKLIFGLSQRFRGSKVLYLDIYSPLIDMIKHPRKYGLEETLRGCCGTGLLEAGP-LCQPLS-RTCDDVSKYLFFDSVHPSQTAYSVIASFALQKLFPLL 361          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL30_ARATH (GDSL esterase/lipase At1g73610 OS=Arabidopsis thaliana GN=At1g73610 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.242e-28
Identity = 71/226 (31.42%), Postives = 116/226 (51.33%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+    +I ++ Q+  ++ Y ++L  V G+++ A+ +I +A+Y++ +G+ D    Y+        YT   Y+  LV+     IK++Y +GARKF V    PLGCLP AR L       C   +N  A  FN+++S+   NL    P  K V  D++ P+  L+ +P  SGF++                 C P     C +AS+YVFWD  HP+Q + + IA ++I
Sbjct:  126 TARTTGSIWVSDQVTDFQNYITRLNGVVGNQEQANAVISNAVYLISAGNNDIAITYFTTGARRLQYTLPAYNDQLVSWTRDLIKSLYDMGARKFAVMGTLPLGCLPGARAL----TRACELFVNQGAAMFNQQLSADIDNLGATFPGAKFVYVDMYNPLLGLIINPQASGFIDVADAC-----------CCTPTHLIPCLDASRYVFWDVAHPTQKSYETIAPQII 336          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GDL23_ARATH1.327e-3032.30GDSL esterase/lipase At1g58430 OS=Arabidopsis thal... [more]
EXL2_ARATH2.263e-3030.14GDSL esterase/lipase EXL2 OS=Arabidopsis thaliana ... [more]
GDL41_ARATH2.956e-3031.76GDSL esterase/lipase At2g30220 OS=Arabidopsis thal... [more]
GDL42_ARATH8.599e-3031.70GDSL esterase/lipase At2g30310 OS=Arabidopsis thal... [more]
GDL44_ARATH1.467e-2931.86GDSL esterase/lipase At2g31550 OS=Arabidopsis thal... [more]
GDL39_ARATH1.467e-2931.44GDSL esterase/lipase At2g24560 OS=Arabidopsis thal... [more]
GDL85_ARATH1.916e-2933.33GDSL esterase/lipase At5g45950 OS=Arabidopsis thal... [more]
GDL43_ARATH1.916e-2931.86GDSL esterase/lipase At2g31540 OS=Arabidopsis thal... [more]
GDL47_ARATH9.508e-2929.87GDSL esterase/lipase At2g40250 OS=Arabidopsis thal... [more]
GDL30_ARATH1.242e-2831.42GDSL esterase/lipase At1g73610 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top