DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: APG_BRANA (Anther-specific proline-rich protein APG (Fragment) OS=Brassica napus GN=APG PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.373e-27
Identity = 67/217 (30.88%), Postives = 111/217 (51.15%), Query Frame = 3
Query:   27 SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            ++  QL Y+++Y+ ++ K+ G K++  I+     IV +GS D +  Y+ N   +     + +++M+ +  +SF+  +YG GAR+ GV   PP+GC P+ R      +  C   +N  AQ FN K+      L K LP+  IV  DI+     +++SP   GF E               F C  ++    SNAS Y+FWD +HPSQ A ++   +L+
Sbjct:  230 TMLDQLTYFQDYKKRMKKLVGKKKTKKIVSKGAAIVVAGSNDLIYTYFGNGAQHLKNDVDSFTTMMADSAASFVLQLYGYGARRIGVIGTPPIGCTPSQRV---KKKKICNEDLNYAAQLFNSKLVIILGQLSKTLPNSTIVYGDIYSIFSKMLESPEDYGFEEIKKPCCKIGLTKGGVF-CKERTLKNMSNASSYLFWDGLHPSQRAYEISNRKLV 442          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EXL6_ARATH (GDSL esterase/lipase EXL6 OS=Arabidopsis thaliana GN=EXL6 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.518e-26
Identity = 72/230 (31.30%), Postives = 116/230 (50.43%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATN--LQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQ 683
            TS     +S   Q++ +++Y  KL +V   K+    I+ +A++++  G+ D    Y+V P L ++ +   Y+S +V     F+K++Y LGARKF V  + P+GCLP  R  FG     C   +N   + FN K+    T+  ++    D K V  DI+  + DLV++P   GF EA                C P +   C +  +YVF+D  HPSQ A +VI+  ++ Q
Sbjct:  121 TSRTLRVLSAGDQVKDFKDYLKKLRRVVKRKKKVKEIVSNAVFLISEGNNDL--GYFVAPALLRLQSTTTYTSKMVVWTRKFLKDLYDLGARKFAVMGVMPVGCLPIHRASFGGVFGWCNFLLNRITEDFNMKLQKGLTSYAVEYDFKDAKFVYVDIYGTLMDLVKNPMAYGFTEAKKAC-----------CCMPNAIIPCFHPDKYVFYDFAHPSQKAYEVISKPIVYQ 337          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL64_ARATH (GDSL esterase/lipase At4g16230 OS=Arabidopsis thaliana GN=At4g16230 PE=2 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 4.417e-26
Identity = 66/221 (29.86%), Postives = 110/221 (49.77%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYY---VNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            I++  QL  +   +  +    G  ++A + + AI+ V +GS D + NY+   ++ L  KV  PE +   +++ F   +  +Y LGARK  V ++ P+GC+P  R       + C++  N  AQ +N K+ +    L K L   + V  D+F+ + D++Q+ S  GF                   C P S   C + S+YVFWD  HP++AAN +IA  L+
Sbjct:  127 INVDAQLDNFATTRQDIISWIGESEAAKLFRSAIFSVTTGSNDLINNYFTPVISTLQRKVVAPEVFVDTMISKFRLQLTRLYQLGARKIVVINIGPIGCIPFERESDPAAGNNCLAEPNEVAQMYNLKLKTLVEELNKNLQGSRFVYGDVFRIVDDIIQNYSSYGFESEKIPCCSLVGKVGGLIPCGPPSK-VCMDRSKYVFWDPYHPTEAANIIIARRLL 346          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL15_ARATH (GDSL esterase/lipase At1g29670 OS=Arabidopsis thaliana GN=At1g29670 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.417e-26
Identity = 71/222 (31.98%), Postives = 118/222 (53.15%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSK-QSASIIKDAIYIVGSGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            L   IS + Q++ Y+   S++ ++ G + ++A  +K  IY VG GS D+L NY++    +  + +TPEQY++ L++ +S+ +  +Y  GARKF ++ +  +GC P A  L G  +   CV RIN+  Q FN K+ S    L    PD K +  + +    D++ +P++ GF                   C P     C + + YVFWD+ HP++AAN +IA
Sbjct:  123 LGQRISFSGQVRNYQTTVSQVVQLLGDETRAADYLKRCIYSVGLGSNDYLNNYFMPTFYSSSRQFTPEQYANDLISRYSTQLNALYNYGARKFALSGIGAVGCSPNA--LAGSPDGRTCVDRINSANQIFNNKLRSLVDQLNNNHPDAKFIYINAYGIFQDMITNPARFGF-RVTNAGCCGIGRNAGQITCLP-GQRPCRDRNAYVFWDAFHPTEAANVIIA 340          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL14_ARATH (GDSL esterase/lipase At1g29660 OS=Arabidopsis thaliana GN=At1g29660 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.678e-25
Identity = 67/221 (30.32%), Postives = 107/221 (48.42%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSKQSAS-IIKDAIYIVGSGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            L   I+ + Q++ Y+   +++ ++ G + +A+  +K  IY VG GS D+L NY++    +  + YTPEQY+  L++ +   +  +Y  GARKF +  +  +GC P A        + CV RIN+  + FN ++ S    L     D      + +    D++ +PS  GF                   C P  P  C N  +YVFWD+ HPS AAN  IA
Sbjct:  123 LGQRITFSGQVENYKNTVAQVVEILGDEYTAADYLKRCIYSVGMGSNDYLNNYFMPQFYSTSRQYTPEQYADDLISRYRDQLNALYNYGARKFALVGIGAIGCSPNALAQGSQDGTTCVERINSANRIFNNRLISMVQQLNNAHSDASFTYINAYGAFQDIIANPSAYGFTNT-NTACCGIGRNGGQLTCLPGEP-PCLNRDEYVFWDAFHPSAAANTAIA 341          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: APG_ARATH (Anter-specific proline-rich protein APG OS=Arabidopsis thaliana GN=APG PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.863e-25
Identity = 71/235 (30.21%), Postives = 113/235 (48.09%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLA----------KVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            TS   +AI +  QL Y+++Y  K+           K+AG +++  +I   + IV  GS D +  Y+ +         + Y++++ +  +SF+  +YG GAR+ GV   PPLGC+P+ R      +  C   +N  +Q FN K+      L K LP+   V  DI+  I  ++++P+  GF E                LC   +   C N S Y+FWD VHP+Q A + I   LI
Sbjct:  295 TSEAANAIPMLDQLTYFQDYIEKVNRLVRQEKSQYKLAGLEKTNQLISKGVAIVVGGSNDLIITYFGSGAQRLKNDIDSYTTIIADSAASFVLQLYGYGARRIGVIGTPPLGCVPSQRL---KKKKICNEELNYASQLFNSKLLLILGQLSKTLPNSTFVYMDIYTIISQMLETPAAYGFEETKKPCCKTGLLSAGA-LCKKSTSKICPNTSSYLFWDGVHPTQRAYKTINKVLI 525          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL56_ARATH (GDSL esterase/lipase At3g43570 OS=Arabidopsis thaliana GN=At3g43570 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 8.329e-25
Identity = 69/225 (30.67%), Postives = 110/225 (48.89%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ +   IS+  QL Y++EY SK+ +  G +++  I++ + ++V S S D    Y         Y    Y++ L +    F++ ++ LGA+K GV S  P+GC+P  RT+FG                             K+L D  I+  +++  ++D++Q P K GF E               +LCN  +  TCSN+S Y+FWDS HPS+ A QVI D L+
Sbjct:  121 TAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQA---HRYDRTSYANFLADSAVHFVRELHKLGAQKIGVFSAVPVGCVPLQRTVFG----------------------------DKEL-DGVILYINVYDTLFDMIQHPKKYGF-EVADRGCCGKGLLTISYLCNSLNQFTCSNSSAYIFWDSYHPSKRAYQVIVDNLL 312          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EXL5_ARATH (GDSL esterase/lipase EXL5 OS=Arabidopsis thaliana GN=EXL5 PE=2 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 8.329e-25
Identity = 68/227 (29.96%), Postives = 113/227 (49.78%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQ--KQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            TS L   +S   Q++ ++ Y+ KL  V G  ++  I+ +++ +V  G+ D    Y ++    ++ TP+ Y+S LV     FIK++Y  GARKF V  + PLGCLP +R +FG     C    NT ++ +NKK+ S   + +        + V  D++  + D++ +  K GF                   C   +   CSN  +YVF+D  HPS+ A + IA +L+
Sbjct:  135 TSKLLRVLSPADQVKDFKGYKRKLKGVVGRSKAKKIVANSVILVSEGNNDIGITYAIHDAGMRLMTPKVYTSKLVGWNKKFIKDLYDHGARKFAVMGVIPLGCLPMSRLIFGGFFVWCNFLANTISEDYNKKLKSGIKSWRGASDFRGARFVYVDMYNSLMDVINNHRKYGFTHEKNGC-----------CCMLTAIVPCSNPDKYVFYDFAHPSEKAYKTIAKKLV 350          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL80_ARATH (GDSL esterase/lipase At5g37690 OS=Arabidopsis thaliana GN=At5g37690 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.165e-24
Identity = 64/224 (28.57%), Postives = 109/224 (48.66%), Query Frame = 3
Query:    9 YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLL--NKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADEL 674
            Y    ++   Q+  +++ +  +    G   +   + DA+Y +G GS D++ N+ + P +   + YT +++  +L +   + +  +Y LGARK     L PLGC+P+ R         C++R+N    +FN +      +L K+LP  K    D +  + DL+ +P+  GF  A               LC P S   C N   +VFWD+ HPS +ANQ++AD L
Sbjct:  121 YFIQRLTFNDQINCFKKTKEVIRAKIGDGAANKHVNDAMYFIGLGSNDYVNNF-LQPFMADGQQYTHDEFVELLTSTLHNQLTTIYKLGARKVIFHGLGPLGCIPSQRVKSKTRM--CLNRVNEWVLEFNSRTKKLLIDLNKRLPGAKFSFADTYPAVLDLINNPTHYGFKIANTSCCNVDTSVGG--LCLPNSK-MCKNRQDFVFWDAFHPSDSANQILADHL 338          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL31_ARATH (GDSL esterase/lipase At1g74460 OS=Arabidopsis thaliana GN=At1g74460 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.570e-23
Identity = 64/224 (28.57%), Postives = 111/224 (49.55%), Query Frame = 3
Query:    9 YLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNK-VYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            Y     SL +Q++ ++  Q  +    G K++    +DA Y+V  GS DF+ NY +    +   Y  + +   L+    S +K ++ LGARK  V  L P+GC+P  R L    +  C ++ +  A++FNK  ++   +L+ +LP+      + +  + D++ +P K GF +                 C P S   C + S+YVFWD  HP+  AN+++A+ LI
Sbjct:  118 YFIQRFSLWKQIELFQGTQDVVVAKIGKKEADKFFQDARYVVALGSNDFINNYLMPVYSDSWKYNDQTFVDYLMETLESQLKVLHSLGARKLMVFGLGPMGCIPLQRALS--LDGNCQNKASNLAKRFNKAATTMLLDLETKLPNASYRFGEAYDLVNDVITNPKKYGF-DNSDSPCCSFYRIRPALTCIPAST-LCKDRSKYVFWDEYHPTDKANELVANILI 337          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
APG_BRANA1.373e-2730.88Anther-specific proline-rich protein APG (Fragment... [more]
EXL6_ARATH1.518e-2631.30GDSL esterase/lipase EXL6 OS=Arabidopsis thaliana ... [more]
GDL64_ARATH4.417e-2629.86GDSL esterase/lipase At4g16230 OS=Arabidopsis thal... [more]
GDL15_ARATH4.417e-2631.98GDSL esterase/lipase At1g29670 OS=Arabidopsis thal... [more]
GDL14_ARATH1.678e-2530.32GDSL esterase/lipase At1g29660 OS=Arabidopsis thal... [more]
APG_ARATH2.863e-2530.21Anter-specific proline-rich protein APG OS=Arabido... [more]
GDL56_ARATH8.329e-2530.67GDSL esterase/lipase At3g43570 OS=Arabidopsis thal... [more]
EXL5_ARATH8.329e-2529.96GDSL esterase/lipase EXL5 OS=Arabidopsis thaliana ... [more]
GDL80_ARATH3.165e-2428.57GDSL esterase/lipase At5g37690 OS=Arabidopsis thal... [more]
GDL31_ARATH4.570e-2328.57GDSL esterase/lipase At1g74460 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top