DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL38_ARATH (GDSL esterase/lipase At2g23540 OS=Arabidopsis thaliana GN=At2g23540 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.018e-22
Identity = 63/223 (28.25%), Postives = 109/223 (48.88%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASII-KDAIYIVGSGSGDFLQNYYVNPLLNK----VYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            + +  Q+ ++   + +   + G +++   I K +I+ +  G+ DFL NY   PLL+       TP+ +   ++      +  +Y L ARKF + ++ P+GC+P  +T+    E+ CV   N  A Q+N ++ S    L K+LP    V  +++  + +L+ +  K GF  A                C P S   C    +YVFWD  HPS+AAN +IA +L+
Sbjct:  149 LGMDVQVDFFNTTRKQFDDLLGKEKAKDYIAKKSIFSITIGANDFLNNYLF-PLLSVGTRFTQTPDDFIGDMLEHLRDQLTRLYQLDARKFVIGNVGPIGCIPYQKTINQLDENECVDLANKLANQYNVRLKSLLEELNKKLPGAMFVHANVYDLVMELITNYDKYGFKSATKACCGNGGQYAGIIPCGPTS-SLCEERDKYVFWDPYHPSEAANVIIAKQLL 369          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GLIP7_ARATH (GDSL esterase/lipase 7 OS=Arabidopsis thaliana GN=GLIP7 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.053e-22
Identity = 57/181 (31.49%), Postives = 94/181 (51.93%), Query Frame = 3
Query:  132 VGSGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            +  GS D++ NY +    +  + Y+ E Y+ +L+   S+ I  +Y LGARK  +    PLGC+P+  ++  G + SGCV++IN     FN ++   A  L   LP    V  ++F   +D+V +PS+ G V +                   + P  C + +QYVFWD+ HP++ AN++IA
Sbjct:  164 INIGSNDYINNYLMPERYSTSQTYSGEDYADLLIKTLSAQISRLYNLGARKMVLAGSGPLGCIPSQLSMVTGNNTSGCVTKINNMVSMFNSRLKDLANTLNTTLPGSFFVYQNVFDLFHDMVVNPSRYGLVVSNEACCGNGRYGGALTCLPLQQP--CLDRNQYVFWDAFHPTETANKIIA 342          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL58_ARATH (GDSL esterase/lipase At3g50400 OS=Arabidopsis thaliana GN=At3g50400 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 8.619e-22
Identity = 63/218 (28.90%), Postives = 110/218 (50.46%), Query Frame = 3
Query:   39 QLQYYREYQSKLAKVAGSKQSASII-KDAIYIVGSGSGDFLQNY---YVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAAT-NLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            Q+ Y+   + +  K+ G  ++   I K +++ V  GS DFL NY   +V        TPE +   +++   + +K +Y + ARKF V ++ P+GC+P  +++   ++  CV   N  A Q+N ++    T  L+  L D   V  +++    DL+ +    GF  A                C P S   C++ S++VFWD+ HP++AAN +IAD+L+
Sbjct:  140 QVDYFTNTRKQFDKLLGQDKARDYIRKRSLFSVVIGSNDFLNNYLVPFVAAQARLTQTPETFVDDMISHLRNQLKRLYDMDARKFVVGNVAPIGCIPYQKSINQLNDKQCVDLANKLAIQYNARLKDLLTVELKDSLKDAHFVYANVYDLFMDLIVNFKDYGFRTASEACCETRGRLAGILPCGPTS-SLCTDRSKHVFWDAYHPTEAANLLIADKLL 356          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL55_ARATH (GDSL esterase/lipase At3g43550 OS=Arabidopsis thaliana GN=At3g43550 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 1.920e-21
Identity = 56/170 (32.94%), Postives = 96/170 (56.47%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSG 509
            T+ +   IS+  QL Y++EY SK+ +  G +++  I++ + ++V S S D    Y         Y    Y++ L +    F++ ++ LGARK GV S  P+GC+P  RT+F G+   GC   +N  A+QFN ++S A  +L K+L D  I+  +++  ++D++Q P K G
Sbjct:  121 TAKIMSVISVWDQLIYFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQA---HRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKEL-DGVIIYINVYDTLFDMIQHPKKYG 286          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL79_ARATH (GDSL esterase/lipase At5g33370 OS=Arabidopsis thaliana GN=At5g33370 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.508e-21
Identity = 55/220 (25.00%), Postives = 107/220 (48.64%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPL--LNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            I +T+QL+Y+ +Y+ +++ + G ++   ++  A+ ++  G  DF+ NYY+ P    ++ ++   Y   +++ +   ++ MY LGAR+  VT   P+GC+PA           C + +   A  FN ++    T+L  ++     +  +  +   D +  P   GFV +               LC P S   C N   + FWD  HPS+ A+++IA +++
Sbjct:  128 IRITKQLEYFEQYKVRVSGLVGEEEMNRLVNGALVLITLGGNDFVNNYYLVPFSARSRQFSLPDYVVFVISEYRKVLRKMYDLGARRVLVTGTGPMGCVPAELAQRS-RNGECATELQRAASLFNPQLIQMITDLNNEVGSSAFIAANTQQMHMDFISDPQAYGFVTSKVACCGQGPYNGIG-LCTPLS-NLCPNRDLFAFWDPFHPSEKASRIIAQQIL 344          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL35_ARATH (GDSL esterase/lipase At2g19010 OS=Arabidopsis thaliana GN=At2g19010 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.508e-21
Identity = 63/225 (28.00%), Postives = 106/225 (47.11%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG--CVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            + +L   IS+ +QLQ ++        +  +   A  ++  +Y++  GS D++ NY+++   N  + YTP+QY+  L+ I+ S +KN++ LGARK  V  L  +GC P    +   H  G  C   +N   + FNK +     +  K++   K    D+F         P    F+                 LC P  P  C+N ++YVFWD +H ++A N V+A
Sbjct:  115 SEHLGDRISIRKQLQNHK------TSITKANVPAERLQQCLYMINIGSNDYINNYFMSKPYNTKRRYTPKQYAYSLIIIYRSHLKNLHRLGARKVAVFGLSQIGCTP---KIMKSHSDGKICSREVNEAVKIFNKNLDDLVMDFNKKVRGAKFTYVDLFSG-----GDPQAFIFLGFKVGGKSCCTVNPGEELCVPNQP-VCANRTEYVFWDDLHSTEATNMVVA 324          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: LTL1_ARATH (GDSL esterase/lipase LTL1 OS=Arabidopsis thaliana GN=LTL1 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.275e-21
Identity = 56/221 (25.34%), Postives = 111/221 (50.23%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPL--LNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG-CVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            I +++Q++Y+ +YQ +++ + G + +  ++  A+ ++  G  DF+ NYY+ P    ++ Y    Y   L++ +   ++ +Y LGAR+  VT    +GC PA   L  +  +G C   + T A  FN ++     ++  ++     V  + ++   D + +P + GFV +               LC P S   C N   Y FWD+ HP++ AN++I ++++
Sbjct:  127 IRISKQMEYFEQYQLRVSALIGPEATQQLVNQALVLITLGGNDFVNNYYLIPFSARSRQYALPDYVVYLISEYGKILRKLYELGARRVLVTGTGAMGCAPA--ELAQHSRNGECYGALQTAAALFNPQLVDLIASVNAEIGQDVFVAANAYQMNMDYLSNPEQFGFVTSKVACCGQGPYNGIG-LCTPVS-NLCPNRDLYAFWDAFHPTEKANRIIVNQIL 343          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL65_ARATH (GDSL esterase/lipase At4g18970 OS=Arabidopsis thaliana GN=At4g18970 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.275e-21
Identity = 62/220 (28.18%), Postives = 103/220 (46.82%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSK-QSASIIKDAIYIVGSGSGDFLQNYYVNPLLN--KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVI 662
            L   I+   Q+  +    S++  + G + ++A+ +   IY +G GS D+L NY++    +    Y+P+ Y++ L+N ++  ++ MY  GARKF +  +  +GC P            C  RIN+  + FN K+ S   +  +  P  K    + +    D+V +PS+ GF                   C P     C N  +YVFWD+ HP +AAN VI
Sbjct:  120 LGARITFAGQVANHVNTVSQVVNILGDENEAANYLSKCIYSIGLGSNDYLNNYFMPVYYSTGSQYSPDAYANDLINRYTEQLRIMYNNGARKFALVGIGAIGCSPNELAQNSRDGVTCDERINSANRIFNSKLVSLVDHFNQNTPGAKFTYINAYGIFQDMVANPSRYGF-RVTNAGCCGVGRNNGQITCLP-GQAPCLNRDEYVFWDAFHPGEAANVVI 337          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: EXL4_ARATH (GDSL esterase/lipase EXL4 OS=Arabidopsis thaliana GN=EXL4 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.278e-21
Identity = 65/228 (28.51%), Postives = 109/228 (47.81%), Query Frame = 3
Query:    3 TSYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLN-KVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQ--LPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            TS L   ++   Q+  ++ Y  KL   AG  +++SI+ +A+ +V  G+ D   +Y+  P    +  TP +Y++ L      F+K +Y  GARKF V  + PLGCLP  R   G     C    N  A+Q+N K+ S   +  ++      K V  D++  + D++++  + GF                   C   +   C N  +YVF+D VHPS+ A + I+ +L+
Sbjct:  119 TSKLLRVLTPKDQVNDFKGYIRKLKATAGPSRASSIVSNAVILVSQGNNDIGISYFGTPTAAFRGLTPNRYTTKLAGWNKQFMKELYDQGARKFAVMGVIPLGCLPMTRIFLGGFVITCNFFANRVAEQYNGKLRSGTKSWGREAGFRGAKFVYVDMYNTLMDVIKNYRRYGFSNEKNGC-----------CCMITAIIPCPNPDKYVFYDFVHPSEKAYRTISKKLV 335          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GLIP5_ARATH (GDSL esterase/lipase 5 OS=Arabidopsis thaliana GN=GLIP5 PE=2 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.245e-20
Identity = 60/217 (27.65%), Postives = 103/217 (47.47%), Query Frame = 3
Query:    6 SYLNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCN----PKSPGTCSNASQYVFWDSVHPSQ 644
            ++    I+L  QL +Y++ +       G ++S   I  A+Y++  GS D+   +  N  L    +  Q+  +++   ++FI  +Y +G RKFG  ++P LGC PA R L   ++  C+   +  A   N+ +++    +Q+Q+   K  +FD+ K +   +Q PSK GF E               F C      K    C N   Y+FWDS+H +Q
Sbjct:  138 TFQGSVINLRTQLDHYKKVERLWRTNFGKEESKKRISRAVYLISIGSNDYSSIFLTNQSLP--ISMSQHVDIVIGNLTTFIHEIYKIGGRKFGFLNVPDLGCFPALRILQPKNDDSCLRDASRLASMHNRALTNLLFQMQRQVKGFKFSLFDMNKSLRLRMQHPSKFGFKEG-EEACCGTGKWRGVFSCGGKRIVKEYQLCENPKDYIFWDSLHLTQ 351          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GDL38_ARATH1.018e-2228.25GDSL esterase/lipase At2g23540 OS=Arabidopsis thal... [more]
GLIP7_ARATH5.053e-2231.49GDSL esterase/lipase 7 OS=Arabidopsis thaliana GN=... [more]
GDL58_ARATH8.619e-2228.90GDSL esterase/lipase At3g50400 OS=Arabidopsis thal... [more]
GDL55_ARATH1.920e-2132.94GDSL esterase/lipase At3g43550 OS=Arabidopsis thal... [more]
GDL79_ARATH2.508e-2125.00GDSL esterase/lipase At5g33370 OS=Arabidopsis thal... [more]
GDL35_ARATH2.508e-2128.00GDSL esterase/lipase At2g19010 OS=Arabidopsis thal... [more]
LTL1_ARATH3.275e-2125.34GDSL esterase/lipase LTL1 OS=Arabidopsis thaliana ... [more]
GDL65_ARATH3.275e-2128.18GDSL esterase/lipase At4g18970 OS=Arabidopsis thal... [more]
EXL4_ARATH4.278e-2128.51GDSL esterase/lipase EXL4 OS=Arabidopsis thaliana ... [more]
GLIP5_ARATH1.245e-2027.65GDSL esterase/lipase 5 OS=Arabidopsis thaliana GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top