DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: LIP4_ARATH (GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana GN=LIP4 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.230e-16
Identity = 54/234 (23.08%), Postives = 104/234 (44.44%), Query Frame = 3
Query:   15 NHAISLTQQLQYYREYQSKLAKVAGSKQSASII-------KDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF---GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF---VEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            N   SL  Q++ +  ++S+  ++A S  S   +       K+A+Y++  G  D  +++      N      +    ++    S IK +Y  G R+F + +  PLGCLP   ++       + GC+   N+ A  FN+ +      L+ +L D  I+  DI+   Y L+ + ++ GF   + A                C  K    C   S+++ WD +H ++ AN ++A +++
Sbjct:  126 NVPFSLNIQVKQFSHFKSRSLELASSSNSLKGMFISNNGFKNALYMIDIGQNDIARSFARG---NSYSQTVKLIPQIITEIKSSIKRLYDEGGRRFWIHNTGPLGCLPQKLSMVKSKDLDQHGCLVSYNSAATLFNQGLDHMCEELRTELRDATIIYIDIYAIKYSLIANSNQYGFKSPLMACCGYGGTPYNYNVKITCGHKGSNVCEEGSRFISWDGIHYTETANAIVAMKVL 356          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL2_ARATH (GDSL esterase/lipase At1g09390 OS=Arabidopsis thaliana GN=At1g09390 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 9.230e-16
Identity = 56/233 (24.03%), Postives = 108/233 (46.35%), Query Frame = 3
Query:   27 SLTQQLQYYREYQSKLAKVAGSKQ-------SASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFS---SFIKNMYGLGARKFGVTSLPPLGCLPAARTLF---GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF---VEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            +L  QL  +  ++S+  ++A             S  ++A+Y++  G  D   ++      +K  +  +   ++ N+ S   S IK +Y  G RKF V +  PLGCLP   ++    G+ + GC++  N  A+ FN+ +     +L+ +L +  IV  DI+   YDL+ + +  GF   + A                C      +C   S+++ WD +H ++ AN ++A +++
Sbjct:  127 ALNIQLMQFLHFKSRALELASISDPLKEMMIGESGFRNALYMIDIGQNDIADSF------SKGLSYSRVVKLIPNVISEIKSAIKILYDEGGRKFWVHNTGPLGCLPQKLSMVHSKGFDKHGCLATYNAAAKLFNEGLDHMCRDLRTELKEANIVYVDIYAIKYDLIANSNNYGFEKPLMACCGYGGPPYNYNVNITCGNGGSKSCDEGSRFISWDGIHYTETANAIVAMKVL 353          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL10_ARATH (GDSL esterase/lipase At1g28610 OS=Arabidopsis thaliana GN=At1g28610 PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 9.230e-16
Identity = 68/235 (28.94%), Postives = 107/235 (45.53%), Query Frame = 3
Query:    9 YLNHAISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            Y +  ISL  QL+ ++E    L  + GS      +I +A  I+G  G  DF   ++VN    K    ++   +++   SS I  +  +G R F V    PLGC     TL+           +GC++ +N  ++ +N+K+ +    L K  P + I+  D F  +  L Q PSK GF++                L   C       CS+ S+YV WD VH ++AA + IAD L+
Sbjct:  130 YPHSNISLGIQLKTFKE---SLPNLCGSPTDCRDMIGNAFIIMGEIGGNDFNFAFFVN----KTSEVKELVPLVITKISSAIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEEYDPLTGCLTWLNDFSEYYNEKLQAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFMDRPLPACCGLGGPYNFTLSKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLL 357          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL81_ARATH (GDSL esterase/lipase At5g41890 OS=Arabidopsis thaliana GN=At5g41890 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.206e-15
Identity = 58/229 (25.33%), Postives = 107/229 (46.72%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLL-----NKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYD----LVQSPSKSGFVEAXXXXXXXXXXXXXXFL--CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            + L +Q+  + + +  + +V G   +  ++K+A++ +  GS D L   Y+ P +     +K+ T     SM++++ ++ +K ++ LG RKF V  + PLGC+P AR L       C  ++N   + +N K+  +   L  +L         ++   YD    LV +    G   A              F       S   C + S++VFWD+ HP++AAN ++A  L+
Sbjct:  126 VPLREQVSNFEKSREYMVRVIGENGTKEMLKNAMFTITIGSNDILN--YIQPSIPFFSQDKLPTDVLQDSMVLHL-TTHLKRLHQLGGRKFVVVGVGPLGCIPFARALNLIPAGKCSEQVNQVVRGYNMKLIHSLKTLNNELRSEDYNTTFVYANSYDLFLKLVLNYQLFGLKNADKPCCGGYFPPFACFKGPNQNSSQAACEDRSKFVFWDAYHPTEAANLIVAKALL 351          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL17_ARATH (GDSL esterase/lipase At1g33811 OS=Arabidopsis thaliana GN=At1g33811 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.206e-15
Identity = 57/222 (25.68%), Postives = 98/222 (44.14%), Query Frame = 3
Query:   18 HAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKV--YTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESG---CVSRINTDAQQFNKKVSSAATNLQK-QLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIA 665
            +  ++ Q L+Y+R   ++L +          +   I+  G GS D+L NY++    +    Y  + ++  L+  ++  +  +Y  GARK  VT +  +GC+P     +    +    C  +IN     FN +V      L K QL   K V  D +K  YDL  + +  GF E                 C P     C + ++Y+FWD+ HP++ AN ++A
Sbjct:  139 YTTAVQQMLRYFRGDTNELQRY---------LSRCIFYSGMGSNDYLNNYFMPDFYSTSTNYNDKTFAESLIKNYTQQLTRLYQFGARKVIVTGVGQIGCIPYQLARYNNRNNSTGRCNEKINNAIVVFNTQVKKLVDRLNKGQLKGAKFVYLDSYKSTYDLAVNGAAYGF-EVVDKGCCGVGRNNGQITCLPLQT-PCPDRTKYLFWDAFHPTETANILLA 349          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GLIP1_ARATH (GDSL esterase/lipase 1 OS=Arabidopsis thaliana GN=GLIP1 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.056e-15
Identity = 57/226 (25.22%), Postives = 94/226 (41.59%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCN-----PKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQG 686
            I+L  QL  +++ +  L    G  +   +I  A+Y+   G  D+   +  N  L +  + E+Y   +V   +   K +Y LG RKFG+ +  P  C PA+  +       C   +       N+K+ +    L  +L   K  + D    + + +  PSK GF E                 C       +S   C N + Y+F+D  H ++ AN+ IA ELI  G
Sbjct:  134 INLRTQLNNFKKVEEMLRSKLGDAEGKRVISRAVYLFHIGLNDYQYPFTTNSSLFQSISNEKYVDYVVGNMTDVFKEVYNLGGRKFGILNTGPYDCAPASLVIDQTKIRSCFQPVTELINMHNEKLLNGLRRLNHELSGFKYALHDYHTSLSERMNDPSKYGFKEGKKACCGSGPLRGIN-TCGGRMGLSQSYELCENVTDYLFFDPFHLTEKANRQIA-ELIWSG 357          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL76_ARATH (GDSL esterase/lipase At5g14450 OS=Arabidopsis thaliana GN=At5g14450 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.056e-15
Identity = 50/166 (30.12%), Postives = 75/166 (45.18%), Query Frame = 3
Query:  222 LVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFG------YHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSP--------GTCSNASQYVFWDSVHPSQAANQVIADELI 677
            +VN  +S ++N+Y  G R F V +  P GCLP      G        +SGCV   N  A +FN+K+     NL+K+L    I   D++   Y+++ +P K GF                 + C  K          G+C N    V WD VH ++AAN+ +AD  +
Sbjct:  207 IVNHLASAVRNIYQQGGRTFWVHNTGPFGCLPVNMFYMGTPAPGYLDKSGCVKAQNEMAMEFNRKLKETVINLRKELTQAAITYVDVYTAKYEMMSNPKKLGFANPLKVCCGYHEKYDHIW-CGNKGKVNNTEIYGGSCPNPVMAVSWDGVHYTEAANKHVADRTL 371          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL91_ARATH (GDSL esterase/lipase At1g28640 OS=Arabidopsis thaliana GN=At1g28640 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.686e-15
Identity = 56/229 (24.45%), Postives = 106/229 (46.29%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGY-----HE--SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            +SL+ QL  +++    L   + S+    ++ D++ ++G  G  D+   ++    +N++   +Q   +++   SS I ++  LG + F V    PLGC PA  TLF       H+  +GC+ R+N   +  N+++ +    LQ+    + I+  D +  ++ L Q P K GF                  +   C  +    C N S+YV WD  H ++A +Q +A  ++
Sbjct:  139 VSLSVQLNIFKQILPNLC-TSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGKSINEI---KQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEEDHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGFKNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVIL 363          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL68_ARATH (GDSL esterase/lipase At4g30140 OS=Arabidopsis thaliana GN=At4g30140 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.814e-15
Identity = 50/221 (22.62%), Postives = 98/221 (44.34%), Query Frame = 3
Query:   12 LNHAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNP--LLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 668
            +   ISL QQ+  +       + +  +    S ++  +Y +  GS D+L NY+++P  L  +++ P+QY+  L++++  ++  +Y LGAR   +  +  +GC P      G   +GC   +N     FN K+ +  T+   + P       D+F        +      +                 LC    P  C + ++++FWD+VH ++  N V+A+
Sbjct:  125 MGERISLRQQVNNH------FSAIITAAVPLSRLRQCLYTINIGSNDYLNNYFLSPPTLARRLFNPDQYARSLISLYRIYLTQLYVLGARNVALFGIGKIGCTPRIVATLG-GGTGCAEEVNQAVIIFNTKLKALVTDFNNK-PGAMFTYVDLFS------GNAEDFAALGITVGDRSCCTVNPGEELCAANGP-VCPDRNKFIFWDNVHTTEVINTVVAN 330          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL11_ARATH (GDSL esterase/lipase At1g28650 OS=Arabidopsis thaliana GN=At1g28650 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.333e-14
Identity = 56/228 (24.56%), Postives = 103/228 (45.18%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGY----HE--SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            ISL+ QL  +++    L   + ++    ++ D++ ++G  G  D+   ++    +N++   ++   +++   SS I ++  LG + F V    P+GC  A  TLF      H+  +GC+  +N   +  N+++      LQK  P + I+  D +  +Y L Q P+K GF                  +   C       C N S+YV WD  H ++A  Q +A  L+
Sbjct:  141 ISLSVQLNTFKQILPNLC-ASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGKSINEI---KELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATVEHDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFKNRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLL 364          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
LIP4_ARATH9.230e-1623.08GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana... [more]
GDL2_ARATH9.230e-1624.03GDSL esterase/lipase At1g09390 OS=Arabidopsis thal... [more]
GDL10_ARATH9.230e-1628.94GDSL esterase/lipase At1g28610 OS=Arabidopsis thal... [more]
GDL81_ARATH1.206e-1525.33GDSL esterase/lipase At5g41890 OS=Arabidopsis thal... [more]
GDL17_ARATH1.206e-1525.68GDSL esterase/lipase At1g33811 OS=Arabidopsis thal... [more]
GLIP1_ARATH2.056e-1525.22GDSL esterase/lipase 1 OS=Arabidopsis thaliana GN=... [more]
GDL76_ARATH2.056e-1530.12GDSL esterase/lipase At5g14450 OS=Arabidopsis thal... [more]
GDL91_ARATH2.686e-1524.45GDSL esterase/lipase At1g28640 OS=Arabidopsis thal... [more]
GDL68_ARATH7.814e-1522.62GDSL esterase/lipase At4g30140 OS=Arabidopsis thal... [more]
GDL11_ARATH1.333e-1424.56GDSL esterase/lipase At1g28650 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top