DC899994

Overview
NameDC899994
Unique NameDC899994
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length854
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1834 contig Csv1_Contig1834:431..1284. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL13_ARATH (GDSL esterase/lipase At1g28670 OS=Arabidopsis thaliana GN=At1g28670 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.128e-12
Identity = 53/229 (23.14%), Postives = 100/229 (43.67%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            +SL+ QL  +++    L   + ++    ++ D++ ++G  G  D+   ++    +N++   ++   ++V   SS I ++  LG + F V    P GC  A  TLF           +GC   +N   +  N+++ +    LQK  P + I+  D    +Y   Q P+K GF                  +   C  +    C N S+YV WD  H ++AA Q + + ++
Sbjct:  139 VSLSVQLDTFKQILPNLC-ASSTRDCKEMLGDSLILMGEIGGNDYNYPFFEGKSINEI---KELVPLIVKAISSAIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEKDQDPLTGCYPLLNEFGEHHNEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTIGKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGIL 363          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: FUCO3_ARATH (Alpha-L-fucosidase 3 OS=Arabidopsis thaliana GN=FXG1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.779e-12
Identity = 56/203 (27.59%), Postives = 83/203 (40.89%), Query Frame = 3
Query:  120 AIYIVGSGSGDFLQNYYVNPLLNKVYT--PEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLF-----GYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEA--XXXXXXXXXXXXXXFLCNPKS---------PGTCSNASQYVFWDSVHPSQAANQVIADEL 674
            A+Y    G  D    Y+ N  + +V T  PE     +++ F + IKN+YG G R F + +  P+GCL      F      +   GCVS +N  AQQFN  +  A   L+  L +  I   D++   ++L       GF  +                  C  K             C    + V WD VH +QAAN+ I D++
Sbjct:  164 ALYTFDIGQNDLTAGYFANKTVEQVETEVPE-----IISQFMNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHALKQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCGMKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKI 361          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL57_ARATH (GDSL esterase/lipase At3g48460 OS=Arabidopsis thaliana GN=At3g48460 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.741e-12
Identity = 51/220 (23.18%), Postives = 91/220 (41.36%), Query Frame = 3
Query:   27 SLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES---GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL--CNPKSPGTCSNASQYVFWDSVHPSQAANQVIAD 668
            S+  +L ++ +Y   L    G+ Q  S+ KD+++ +G  G  D+         L    + +    + ++ F+ F++ +   G +   V   P  GCL  A +L    +    GCV   N  +   N  + S    L+ + P   IV  D +     +++ PSK G  E                   C   +   C + +QY+ WD VH ++A  +V+AD
Sbjct:  149 SIETELAWFEKYLETL----GTNQKVSLFKDSLFWIGEIGVNDYAYT------LGSTVSSDTIRELSISTFTRFLETLLNKGVKYMLVQGHPATGCLTLAMSLAAEDDRDSLGCVQSANNQSYTHNLALQSKLKQLRIKYPSATIVYADYWNAYRAVIKHPSKYGITEKFKACCGIGEPYNFQVFQTCGTDAATVCKDPNQYINWDGVHLTEAMYKVMAD 358          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL16_ARATH (GDSL esterase/lipase At1g31550 OS=Arabidopsis thaliana GN=At1g31550 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.741e-12
Identity = 58/237 (24.47%), Postives = 108/237 (45.57%), Query Frame = 3
Query:   18 HAISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGS-GSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELIVQGFAL 695
            H  SL  QL+ +++    L  +    +   +I +A+ ++G  G+ D+   ++    L++V   ++   ++++  SS I  + G+G R F V    PLGC  A  TL            +GC+  +N   +  ++++      L+K  P + I+  D +     L + PSK GF+                 L   C       CS+ S+YV WD +H ++AA++ +AD L+   +A+
Sbjct:  137 HNFSLGVQLKIFKQSLPNLCGLPSDCRD--MIGNALILMGEIGANDYNFPFFQLRPLDEV---KELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNMEEYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGFINRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKGPYAI 368          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL54_ARATH (GDSL esterase/lipase At3g27950 OS=Arabidopsis thaliana GN=At3g27950 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.191e-12
Identity = 52/227 (22.91%), Postives = 96/227 (42.29%), Query Frame = 3
Query:   33 TQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSF---IKNMYGLGARKFGVTSLPPLGCLPAARTLFGY---HESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVE-----AXXXXXXXXXXXXXXFLCNPK-SPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            T+ L  Y +   K  +++ +    +    A+Y +  G  D    +       +  T EQ  + +  I  +F   +K +Y  GAR F + +  P GCLP     F        GC+  +N  A +FNK++ +  T L+K+LP       D++   Y+L+      GF++                    FL   +    +C N   ++ WD +H ++ AN ++A+ ++
Sbjct:  136 TRTLSLYNQTNGKFNRLSHT----NYFSKALYTLDIGQNDLAIGF-------QNMTEEQLKATIPLIIENFTIALKLLYKEGARFFSIHNTGPTGCLPYLLKAFPAIPRDPYGCLKPLNNVAIEFNKQLKNKITQLKKELPSSFFTYVDVYSAKYNLITKAKALGFIDPFDYCCVGAIGRGMGCGKTIFLNGTELYSSSCQNRKNFISWDGIHYTETANMLVANRIL 351          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL21_ARATH (GDSL esterase/lipase At1g54030 OS=Arabidopsis thaliana GN=At1g54030 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.191e-12
Identity = 54/210 (25.71%), Postives = 89/210 (42.38%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSASIIKDAIYIVGSGSGDFLQNYYVNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHESGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFLCNPKSPGTCSNASQYVFWDSVHPSQAAN 653
            ++L+QQ++ + E ++K      S        +AIY++  GS D+L     NP  +     + +   ++    + IK +YG G RKF   +L PLGCLPA +   G +   CV   +  A   NKK+      L ++L   +   +D F  I + V       F                    N  +   C+   +Y+F+D  H +Q AN
Sbjct:  142 MTLSQQVKKFSENKNKWTNQTRS--------EAIYLIYIGSDDYLSYAKSNPSPSDTQK-QAFVDQVITTIKAEIKVVYGSGGRKFAFQNLAPLGCLPAVKQASG-NVQECVKLPSEMAALHNKKLLQLLVELSRELNGFQYSFYDFFSSIQNRVIKSKTYTFETGNAACCGTGSING----SNCSAKNVCAKPEEYIFFDGKHLTQEAN 337          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL9_ARATH (GDSL esterase/lipase At1g28600 OS=Arabidopsis thaliana GN=At1g28600 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.801e-11
Identity = 57/231 (24.68%), Postives = 100/231 (43.29%), Query Frame = 3
Query:   24 ISLTQQLQYYREYQSKLAKVAGSKQSA-SIIKDAIYIVGSGSGDFLQNYYVNPLLNK--VYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHE-------SGCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGFVEAXXXXXXXXXXXXXXFL---CNPKSPGTCSNASQYVFWDSVHPSQAANQVIADELI 677
            +SL  QL   + ++  L  + GS      +I +A+ ++G   G    N Y  P  N+  V   E+    ++   SS I  + G+G + F V    P+GC     TL+           +GC+  +N   +  ++K+      L+K  P + I+  D +  +  + + P+K GF+E                    C      +C + S+YV WD VH ++AA + IAD ++
Sbjct:  134 VSLGVQL---KSFKKSLPNLCGSPSDCRDMIGNALILMGEIGG----NDYNFPFFNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKDEYDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGFMERPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGIL 357          
BLAST of DC899994 vs. ExPASy Swiss-Prot
Match: GDL61_ARATH (GDSL esterase/lipase At4g01130 OS=Arabidopsis thaliana GN=At4g01130 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.801e-11
Identity = 51/206 (24.76%), Postives = 88/206 (42.72%), Query Frame = 3
Query:   99 SASIIKDAIYIVGSGSGDFLQNYY-VNPLLNKVYTPEQYSSMLVNIFSSFIKNMYGLGARKFGVTSLPPLGCLPAARTLFGYHES-----GCVSRINTDAQQFNKKVSSAATNLQKQLPDLKIVIFDIFKPIYDLVQSPSKSGF---VEAXXXXXXXXXXXXXXFLC-NPKSPG-------TCSNASQYVFWDSVHPSQAANQVIA 665
            S  +   ++Y    G  DF  N   +     K+Y P+     ++   +  IK +YG+G R F V +L P+GC PA  T + + ++     GC+  +N   + +N  ++   +  + +L +  ++  D  K + DL Q P   G    ++A                C N K  G        C +   YV WD +H ++AAN  I+
Sbjct:  161 SKIVFGKSLYTFYIGQNDFTSNLASIGVERVKLYLPQ-----VIGQIAGTIKEIYGIGGRTFLVLNLAPVGCYPAILTGYTHTDADLDKYGCLIPVNKAVKYYNTLLNKTLSQTRTELKNATVIYLDTHKILLDLFQHPKSYGMKHGIKACCGYGGRPYNFNQKLFCGNTKVIGNFSTTAKACHDPHNYVSWDGIHATEAANHHIS 361          
The following BLAST results are available for this feature:
BLAST of DC899994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
GDL13_ARATH2.128e-1223.14GDSL esterase/lipase At1g28670 OS=Arabidopsis thal... [more]
FUCO3_ARATH2.779e-1227.59Alpha-L-fucosidase 3 OS=Arabidopsis thaliana GN=FX... [more]
GDL57_ARATH4.741e-1223.18GDSL esterase/lipase At3g48460 OS=Arabidopsis thal... [more]
GDL16_ARATH4.741e-1224.47GDSL esterase/lipase At1g31550 OS=Arabidopsis thal... [more]
GDL54_ARATH6.191e-1222.91GDSL esterase/lipase At3g27950 OS=Arabidopsis thal... [more]
GDL21_ARATH6.191e-1225.71GDSL esterase/lipase At1g54030 OS=Arabidopsis thal... [more]
GDL9_ARATH1.801e-1124.68GDSL esterase/lipase At1g28600 OS=Arabidopsis thal... [more]
GDL61_ARATH1.801e-1124.76GDSL esterase/lipase At4g01130 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899994 VSS Citrus sinensis cDNA clone VS27Q05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899994 ID=DC899994|Name=DC899994|organism=Citrus sinensis|type=EST|length=854bp
GGACATCCTACTTAAATCATGCAATTTCATTGACTCAGCAGTTGCAGTAC
TATAGAGAGTACCAGAGTAAGCTAGCAAAGGTAGCCGGTAGCAAACAATC
AGCTTCCATAATCAAGGATGCGATATACATAGTGGGTTCTGGGAGTGGTG
ACTTTCTTCAGAATTACTATGTCAATCCTTTACTTAACAAAGTCTACACT
CCTGAGCAGTATAGCTCAATGCTTGTCAATATTTTCTCAAGTTTTATTAA
GAACATGTATGGATTGGGGGCAAGAAAATTTGGAGTGACTTCACTGCCAC
CATTGGGTTGCCTTCCAGCAGCAAGAACTTTATTTGGATATCACGAGAGC
GGCTGTGTCTCTAGAATCAATACTGATGCTCAACAATTTAACAAGAAGGT
CAGCTCCGCAGCAACAAATCTTCAAAAGCAACTTCCTGATCTGAAAATTG
TGATTTTCGACATTTTCAAGCCAATCTATGACCTTGTCCAGTCCCCTTCA
AAATCTGGCTTCGTGGAGGCAACAAGAGGTTGCTGTGGAACAGGAACTGT
AGAAACAACTGTCTTTCTGTGCAATCCAAAGTCGCCTGGAACATGCTCCA
ATGCCTCTCAGTATGTGTTCTGGGACAGTGTTCATCCTTCTCAGGCTGCT
AATCAGGTTATTGCCGATGAATTGATTGTTCAAGGATTTGCCCTTCTCTG
AAGGGGATGTCAAATCCATGGAAATGATCAATATTTCTGTTGAGGCTTCT
TAATCTTCTTGGTGTCTGTGCTTCAGTTTATCAGCTTGTCTATACATCAT
TTTAAGATTTCCTTTGTTTCTTCTAACATTTGCTATATATACATAGTGTT
TTGC
back to top