DC899993

Overview
NameDC899993
Unique NameDC899993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length528
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13C_TOBAC (Glucan endo-1,3-beta-glucosidase OS=Nicotiana tabacum GN=SP41A PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.047e-26
Identity = 62/126 (49.21%), Postives = 83/126 (65.87%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L YALF  +          Y NLFDA++D+ + A+EK   PNV + +SESGWPS GN   T IENAQ Y +NL++HV GG GTP++PG+  +T+LF MF+EN+K   V E++FG FYPN    Y
Sbjct:  222 VPLSYALFNQQGTNSTG----YQNLFDALLDSIYFAVEKAGGPNVEIIVSESGWPSEGNSAAT-IENAQTYYRNLVNHVKGGAGTPKKPGRIVETYLFAMFDENEKNGEVTEKHFGLFYPNRTAKY 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_PHAVU (Glucan endo-1,3-beta-glucosidase, basic isoform OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.047e-26
Identity = 61/127 (48.03%), Postives = 85/127 (66.93%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIYPF 386
            ISL YALF S + VVRDG Y Y NLFDAM+D+ H+A++   +  V + +SESGWPS G    T  +NA+ Y  NL+     G+G+PRRP +  +T++F MF+ENQK   +E++FG F P+ +  YPF
Sbjct:  190 ISLPYALFTSPNVVVRDGQYGYQNLFDAMLDSVHAAIDNTRIGYVEVVVSESGWPSDGGFGAT-YDNARVYLDNLVRR--AGRGSPRRPSKPTETYIFAMFDENQKSPEIEKHFGLFKPSKEKKYPF 313          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_VITVI (Glucan endo-1,3-beta-glucosidase OS=Vitis vinifera GN=GSVIVT00022223001 PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.047e-26
Identity = 63/127 (49.61%), Postives = 86/127 (67.72%), Query Frame = 3
Query:    3 HISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPA-GVEQNFGFFYPNMQPIY 380
            +I LDYALF +   VV+DG Y Y NLFDA++DA ++ALEK    N+ + +SESGWPS G    T ++NA+ Y KNL++HV G  GTPR+ G   +T+LF MF+ENQK     E++FG F P+ +  Y
Sbjct:  159 NIRLDYALFTASGVVVQDGSYQYQNLFDALLDALYAALEKAGGSNLKIVVSESGWPSEGGTAAT-VDNARTYYKNLINHVKG--GTPRKSG-AIETYLFAMFDENQKTGLETEKHFGLFTPSQESKY 281          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_PRUPE (Glucan endo-1,3-beta-glucosidase, basic isoform OS=Prunus persica GN=GNS1 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.047e-26
Identity = 60/125 (48.00%), Postives = 86/125 (68.80%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            I LDYALF +   VV+DG + Y NLFDAM+D  ++ALEK    ++ + ISE+GWPSA     T+I+NA+ +  NL+ HV   +GTPRRPG+  +T++F MF+EN+K   +E+++G F P  QP Y
Sbjct:  224 IRLDYALFTAPSVVVQDGNFGYRNLFDAMLDGVYAALEKAGGGSLKVVISETGWPSAAGTA-TTIDNARTFISNLIQHV--KEGTPRRPGRPIETYIFAMFDENRKTPELEKHWGLFSPTKQPKY 345          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13A_SOYBN (Glucan endo-1,3-beta-glucosidase OS=Glycine max PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.980e-26
Identity = 64/126 (50.79%), Postives = 86/126 (68.25%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYP-NMQPIY 380
            ISLDYALF+S   VV+DG   Y NLFDA VDA ++ALEK    ++ + +SESGWPS+G    TS++NA+ YN NL+ +V   +GTP+RPG   +T++F MF+ENQK    E+ +G F P   QP Y
Sbjct:  220 ISLDYALFRSPSVVVQDGSLGYRNLFDASVDAVYAALEKAGGGSLNIVVSESGWPSSGGTA-TSLDNARTYNTNLVRNV--KQGTPKRPGAPLETYVFAMFDENQKQPEFEKFWGLFSPITKQPKY 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_HEVBR (Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform OS=Hevea brasiliensis GN=HGN1 PE=1 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 1.975e-25
Identity = 61/120 (50.83%), Postives = 80/120 (66.67%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPN 365
            ISL YALF S   VV DG   Y NLFDA +DA +SALE+    ++ + +SESGWPSAG    T  +N + Y  NL+ HV G  GTP+RP +  +T+LF MF+EN+K   VE++FG F+PN
Sbjct:  226 ISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSESGWPSAGAFAAT-FDNGRTYLSNLIQHVKG--GTPKRPNRAIETYLFAMFDENKKQPEVEKHFGLFFPN 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13A_SOLLC (Glucan endo-1,3-beta-glucosidase A OS=Solanum lycopersicum PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.975e-25
Identity = 59/127 (46.46%), Postives = 86/127 (67.72%), Query Frame = 3
Query:    3 HISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPA-GVEQNFGFFYPNMQPIY 380
            ++ L YALF+ +   + D  Y   NLFDA+VD+ + A EK+   N+ + +SESGWPS G+ P  ++ENA  Y  NL++HV GG GTP++PG+T +T+LF MF+EN+K     EQ+FG F P+ +P Y
Sbjct:  210 NVPLPYALFKQQG--LNDAGY--QNLFDALVDSMYFATEKLGGQNIEIIVSESGWPSEGH-PSATLENAMTYYTNLINHVKGGAGTPKKPGRTIETYLFAMFDENRKDGKPSEQHFGLFKPDQRPKY 331          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13K_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform GL161 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.747e-25
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIYPFWPC*KHLSFTYTAV 428
            +SL YALF  +          Y NLFDA++D+ + A+EK   PNV + +SESGWPS G+   T IENAQ Y +NL++HV  G GTP++PG+T +T+LF MF+EN K   + E++FG F P+ +  Y        L+F Y  +
Sbjct:  198 VSLSYALFTQQGTNSAG----YQNLFDAILDSMYFAVEKAGGPNVEIIVSESGWPSEGSSAAT-IENAQTYYRNLINHVKSGAGTPKKPGKTIETYLFAMFDENDKIGEITEKHFGLFSPDQRAKY-------QLNFNYLPI 327          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13I_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform PR-N (Fragment) OS=Nicotiana tabacum GN=PRN PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.747e-25
Identity = 58/126 (46.03%), Postives = 82/126 (65.08%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L YALF  ++      P  Y NLFDA++D+ + A+EK    NV + +SESGWPS GN   T IENAQ Y +NL++HV  G GTP++PG+  +T+LF MF+EN K   + E++FG F P+ +  Y
Sbjct:  150 VPLSYALFTQQEA----NPAGYQNLFDALLDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAAT-IENAQTYYENLINHVKSGAGTPKKPGKAIETYLFAMFDENNKEGDITEKHFGLFSPDQRAKY 270          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13G_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform GI9 OS=Nicotiana tabacum GN=PR2 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 5.747e-25
Identity = 58/126 (46.03%), Postives = 82/126 (65.08%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L YALF  ++      P  Y NLFDA++D+ + A+EK    NV + +SESGWPS GN   T IENAQ Y +NL++HV  G GTP++PG+  +T+LF MF+EN K   + E++FG F P+ +  Y
Sbjct:  218 VPLSYALFTQQEA----NPAGYQNLFDALLDSMYFAVEKAGGQNVEIIVSESGWPSEGNSAAT-IENAQTYYENLINHVKSGAGTPKKPGKAIETYLFAMFDENNKEGDITEKHFGLFSPDQRAKY 338          
The following BLAST results are available for this feature:
BLAST of DC899993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
E13C_TOBAC1.047e-2649.21Glucan endo-1,3-beta-glucosidase OS=Nicotiana taba... [more]
E13B_PHAVU1.047e-2648.03Glucan endo-1,3-beta-glucosidase, basic isoform OS... [more]
E13B_VITVI3.047e-2649.61Glucan endo-1,3-beta-glucosidase OS=Vitis vinifera... [more]
E13B_PRUPE3.047e-2648.00Glucan endo-1,3-beta-glucosidase, basic isoform OS... [more]
E13A_SOYBN3.980e-2650.79Glucan endo-1,3-beta-glucosidase OS=Glycine max PE... [more]
E13B_HEVBR1.975e-2550.83Glucan endo-1,3-beta-glucosidase, basic vacuolar i... [more]
E13A_SOLLC1.975e-2546.46Glucan endo-1,3-beta-glucosidase A OS=Solanum lyco... [more]
E13K_TOBAC5.747e-2543.66Glucan endo-1,3-beta-glucosidase, acidic isoform G... [more]
E13I_TOBAC5.747e-2546.03Glucan endo-1,3-beta-glucosidase, acidic isoform P... [more]
E13G_TOBAC5.747e-2546.03Glucan endo-1,3-beta-glucosidase, acidic isoform G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899993 VSS Citrus sinensis cDNA clone VS27Q04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899993 ID=DC899993|Name=DC899993|organism=Citrus sinensis|type=EST|length=528bp
CTCACATATCCTTAGACTATGCCTTATTTCAGTCGAAAGATCCTGTAGTT
AGAGACGGGCCATACTTGTATTATAATCTATTTGATGCCATGGTTGATGC
TTTTCACTCAGCTCTGGAGAAGATTGATGTACCGAATGTGACTTTGGCCA
TATCAGAGTCAGGATGGCCTAGTGCTGGCAATGAGCCTTATACAAGCATA
GAAAATGCACAAAAATATAATAAGAACTTGATGGATCATGTCTTGGGAGG
AAAAGGGACTCCGAGGAGGCCAGGTCAAACTTTTGATACATTTTTATTTG
AGATGTTCAATGAGAATCAAAAGCCTGCTGGGGTTGAGCAGAATTTCGGA
TTCTTCTATCCAAATATGCAGCCAATTTATCCATTTTGGCCATGCTAGAA
GCATTTATCTTTTACTTATACTGCTGTAATGTAAGCGTGGTGCCTAATTT
GAAAAAGTAACTTATGAAGCAAGTTACACCTTTGCTTTTGCTAAGTAATA
AAAGAATAGATAGTANTTAATTAAAAAA
back to top