DC899993

Overview
NameDC899993
Unique NameDC899993
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length528
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13A_ARATH (Glucan endo-1,3-beta-glucosidase, acidic isoform OS=Arabidopsis thaliana GN=BG2 PE=1 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 1.084e-23
Identity = 56/126 (44.44%), Postives = 83/126 (65.87%), Query Frame = 3
Query:    3 HISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            +I LDYALF ++  V  D  Y Y NLFDA +D+ ++ALEK    ++ + +SE+GWP+ G    TS+ENA+ Y  NL+ HV    G+PRRPG+  +T++F MF+EN+K    E+ +G F+P+ Q  Y
Sbjct:  212 NIHLDYALFTAQSTVDNDPGYSYQNLFDANLDSVYAALEKSGGGSLEIVVSETGWPTEG-AVGTSVENAKTYVNNLIQHV--KNGSPRRPGKAIETYIFAMFDENKKEPTYEKFWGLFHPDRQSKY 334          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_NICPL (Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform OS=Nicotiana plumbaginifolia GN=GN2 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.416e-23
Identity = 59/125 (47.20%), Postives = 84/125 (67.20%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL Y+LF + + VV+DG   Y NLFDAM+D+ ++ALE+    +V + +SESGWPSAG    T  +NA  Y KNL+ H    +G+PR+P +  +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  223 ISLPYSLFTAPNVVVQDGSRQYRNLFDAMLDSVYAALERSGGASVGIVVSESGWPSAGAFGAT-YDNAATYLKNLIQH--AKEGSPRKP-RPIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 343          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E132_SOLTU (Glucan endo-1,3-beta-glucosidase, basic isoform 2 OS=Solanum tuberosum GN=GLUB2 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 1.849e-23
Identity = 58/125 (46.40%), Postives = 83/125 (66.40%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGVEQNFGFFYPNMQPIY 380
            ISL YALF + + VV+DG   Y NLFDAM+D+ ++A+E+    +V + +SE GWPSAG    T  +NA  Y +NL+ H    +G+PR+PG   +T++F MF+EN K   +E++FG F PN QP Y
Sbjct:  215 ISLPYALFTAPNVVVQDGSRQYRNLFDAMLDSVYAAMERTGGGSVGIVVSECGWPSAGAFGATQ-DNAATYLRNLIQH--AKEGSPRKPG-PIETYIFAMFDENNKNPELEKHFGLFSPNKQPKY 335          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.415e-23
Identity = 52/132 (39.39%), Postives = 86/132 (65.15%), Query Frame = 3
Query:    3 HISLDYALFQSKDPVVRDGP-YLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGN---EPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV--EQNFGFFYPNMQPIY 380
            ++SLDY LF+S   V+      LY N+FDA VDA + AL  ++   + + ++E+GWP+ G+   +   S +NA+ YN N++ HV+  +GTP +PG+  + ++F +FNEN+K AG+  E+N+G FYP+   +Y
Sbjct:  212 NVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVTETGWPTKGSPKEKAAASSDNAETYNSNIIRHVVTNQGTPAKPGEAMNVYIFSLFNENRK-AGLDSERNWGLFYPDQTSVY 342          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13C_HORVU (Glucan endo-1,3-beta-glucosidase GIII OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.565e-22
Identity = 58/126 (46.03%), Postives = 78/126 (61.90%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAG-VEQNFGFFYPNMQPIY 380
            I L +A F      V D    Y NLFDAMVD+ ++ALEK   P V + ISESGWPS      T+ +NA+ YN+ L++HV  G G+P++ G   ++++F MFNEN K    +E+NFG F PNM P Y
Sbjct:  205 IQLTFATFVPGSTTVNDNGLTYTNLFDAMVDSIYAALEKAGTPGVKVVISESGWPSDQGFGATA-QNARAYNQGLINHV--GNGSPKKAG-ALESYIFAMFNENLKDGDELEKNFGLFKPNMSPAY 326          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13B_HORVU (Glucan endo-1,3-beta-glucosidase GII OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 7.767e-22
Identity = 62/128 (48.44%), Postives = 81/128 (63.28%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRD--GPYLYYNLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPA-GVEQNFGFFYPNMQPIY 380
            ISL+YA FQ     VRD      Y +LFDAMVDA ++ALEK   P V + +SESGWPSAG     S  NA+ YN+ L++HV  G GTP++  +  +T++F MFNENQK     E++FG F P+  P Y
Sbjct:  208 ISLNYATFQP-GTTVRDQNNGLTYTSLFDAMVDAVYAALEKAGAPAVKVVVSESGWPSAGGFA-ASAGNARTYNQGLINHV--GGGTPKK-REALETYIFAMFNENQKTGDATERSFGLFNPDKSPAY 330          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E13A_HORVU (Glucan endo-1,3-beta-glucosidase GI OS=Hordeum vulgare PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.014e-21
Identity = 61/129 (47.29%), Postives = 81/129 (62.79%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYYN--LFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGNEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIYP 383
            I L+YA F+     VRD      +  LFDAMVDA  +ALE+   P V + +SESGWPSA     T+ +NA+ YN+ L+DHV  G GTP+RPG   +T++F MFNEN K   + E++FG F P+  P YP
Sbjct:  182 IQLNYATFRPGTTTVRDPNTGLTSQCLFDAMVDAVVAALERSGAPGVRVVVSESGWPSASGFAATA-DNARAYNQGLIDHV--GGGTPKRPG-ALETYIFAMFNENFKTGELTEKHFGLFNPDKSPAYP 306          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 2.952e-21
Identity = 53/132 (40.15%), Postives = 81/132 (61.36%), Query Frame = 3
Query:    6 ISLDYALFQSKDP---VVRDGPYLYY-NLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAGN--EPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNEN-QKPAGVEQNFGFFYPNMQPIY 380
            + LD  LF+   P   +V     L+Y N+ DAMVDA + +++ ++V +V + ++ESGWPS G+  EPY +I+NA  YN NL+ HV    GTP  P  T   +++E+FNE+ + P   E ++G FY N  P+Y
Sbjct:  121 VPLDNCLFEPLTPSKEMVDPNTLLHYTNVLDAMVDAAYVSMKNLNVSDVAVLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVY 252          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500/F10A12.18 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 8.588e-21
Identity = 54/129 (41.86%), Postives = 78/129 (60.47%), Query Frame = 3
Query:    6 ISLDYALFQSKDPVVRDGPYLYY-NLFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIY 380
            + L+Y LFQ    +V     L+Y N+  A VDA +SA++ +   ++ + ISE+GWPS G  NE   S ENA  YN NL+  +   KGTP +     D ++F +FNEN KP  V E+N+G FYP+ +P+Y
Sbjct:  216 VPLEYVLFQPNQGMVDPNTNLHYDNMLFAQVDALYSAIKTLGHTDIEVRISETGWPSKGDENEIGASPENAALYNGNLLKLIQQRKGTPAKQSVPIDVYVFALFNENLKPGPVSERNYGLFYPDGKPVY 344          
BLAST of DC899993 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.499e-20
Identity = 49/131 (37.40%), Postives = 83/131 (63.36%), Query Frame = 3
Query:   12 LDYALFQSKDPV---VRDGPYLYYN-LFDAMVDAFHSALEKIDVPNVTLAISESGWPSAG--NEPYTSIENAQKYNKNLMDHVLGGKGTPRRPGQTFDTFLFEMFNENQKPAGV-EQNFGFFYPNMQPIYP 383
            LDYALF+   PV   V     L+YN +FDAMVDA + ++E ++   + + ++E+GWPS+G  +E   ++ NA+ +N NL+  VL   G P +P    +T+++E++NE+++   V E+N+G  +PN   +YP
Sbjct:  214 LDYALFKQLSPVKQIVDPNTLLHYNSMFDAMVDAAYYSMEALNFSKIPVVVTETGWPSSGGSDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYP 344          
The following BLAST results are available for this feature:
BLAST of DC899993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
E13A_ARATH1.084e-2344.44Glucan endo-1,3-beta-glucosidase, acidic isoform O... [more]
E13B_NICPL1.416e-2347.20Glucan endo-1,3-beta-glucosidase, basic vacuolar i... [more]
E132_SOLTU1.849e-2346.40Glucan endo-1,3-beta-glucosidase, basic isoform 2 ... [more]
E1313_ARATH2.415e-2339.39Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis... [more]
E13C_HORVU1.565e-2246.03Glucan endo-1,3-beta-glucosidase GIII OS=Hordeum v... [more]
E13B_HORVU7.767e-2248.44Glucan endo-1,3-beta-glucosidase GII OS=Hordeum vu... [more]
E13A_HORVU1.014e-2147.29Glucan endo-1,3-beta-glucosidase GI OS=Hordeum vul... [more]
E131_ARATH2.952e-2140.15Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E1314_ARATH8.588e-2141.86Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis... [more]
E134_ARATH2.499e-2037.40Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC899993 VSS Citrus sinensis cDNA clone VS27Q04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC899993 ID=DC899993|Name=DC899993|organism=Citrus sinensis|type=EST|length=528bp
CTCACATATCCTTAGACTATGCCTTATTTCAGTCGAAAGATCCTGTAGTT
AGAGACGGGCCATACTTGTATTATAATCTATTTGATGCCATGGTTGATGC
TTTTCACTCAGCTCTGGAGAAGATTGATGTACCGAATGTGACTTTGGCCA
TATCAGAGTCAGGATGGCCTAGTGCTGGCAATGAGCCTTATACAAGCATA
GAAAATGCACAAAAATATAATAAGAACTTGATGGATCATGTCTTGGGAGG
AAAAGGGACTCCGAGGAGGCCAGGTCAAACTTTTGATACATTTTTATTTG
AGATGTTCAATGAGAATCAAAAGCCTGCTGGGGTTGAGCAGAATTTCGGA
TTCTTCTATCCAAATATGCAGCCAATTTATCCATTTTGGCCATGCTAGAA
GCATTTATCTTTTACTTATACTGCTGTAATGTAAGCGTGGTGCCTAATTT
GAAAAAGTAACTTATGAAGCAAGTTACACCTTTGCTTTTGCTAAGTAATA
AAAGAATAGATAGTANTTAATTAAAAAA
back to top