CN185528

Overview
NameCN185528
Unique NameCN185528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9471 contig Csv1_Contig9471:189..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_PICGU (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Pichia guilliermondii GN=PAB1 PE=3 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.461e-13
Identity = 50/178 (28.09%), Postives = 87/178 (48.88%), Query Frame = 2
Query:   92 APDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            A +   +   SL++G+L P + E+ +  IF   G+  S +V R+  T  S GY ++ F  HA   R ++  N + +    +  R+ W+      RR  DG    IF+ +L   + +  L +TF A +  +   KV TD   G+SK +GFV +        ++  +NG+L + R + +G
Sbjct:   49 AGEEGEEASASLYVGELNPSVNEALLFEIFSPIGQVSSIRVCRDAVTKKSLGYAYVNFHKHADGSRAIEELNYSLVDG--RPCRIMWSQRDPSLRRNGDG---NIFIKNLHPAIDNKALHDTFSA-FGRILSCKVATDE-LGQSKCFGFVHYETAEAAEAAIENVNGMLLNDREVFVG 219          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: EPABA_XENLA (Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-A PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 1.461e-13
Identity = 53/184 (28.80%), Postives = 94/184 (51.09%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTE------QNFRLNWATYGAGERRQDDGPDFT-IFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P     G+ +++I +L   ++   +   F   G  +S KV+ ++    S GYGF+ F +H AA R +QT NG  +   +      ++ R     YGA         +FT +++ +   D+ D  L+E F A + +    KV+ D  +GRS+G+GFV +G+  E  ++++EMNG   + R + +G
Sbjct:   91 PGLRKSGVGNVFIKNLDESIDNKALYDTFSAFGNILSCKVVCDEHG--SRGYGFVHFETHEAANRAIQTMNGMLLNDRKVFVGHFKSRRERELEYGAKVM------EFTNVYIKNFGEDMDDKRLREIFSA-FGNTLSVKVMMD-DSGRSRGFGFVNYGNHEEAQKAVSEMNGKEVNGRMIYVG 264          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV4_RAT (ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.461e-13
Identity = 46/164 (28.05%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  101 ASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            A+ D   +L +  L   M +    S+FG  GE  S K++R+K T  S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   33 ATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNG 188          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV4_MOUSE (ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.461e-13
Identity = 46/164 (28.05%), Postives = 85/164 (51.83%), Query Frame = 2
Query:  101 ASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            A+ D   +L +  L   M +    S+FG  GE  S K++R+K T  S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   45 ATDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNG 200          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_NEUCR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neurospora crassa GN=pab-1 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.908e-13
Identity = 50/177 (28.25%), Postives = 90/177 (50.85%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P AS+    SL++G+L P + E+ +  +F   G   S +V R+  T  S GY ++ + + A  E+ L+  N T +    +  R+ W+      R+   G    IF+ +L A + +  L +TF A + ++   KV  D   G SKGYGFV +  +    +++  +NG+L + + + +G
Sbjct:   56 PQASA----SLYVGELDPSVTEAMLFELFSQIGSVASIRVCRDAVTRRSLGYAYVNYNTTADGEKALEELNYTLIKG--RPCRIMWSQRDPALRKTGAG---NIFIKNLDAAIDNKALHDTF-AAFGNILSCKVAQDE-HGNSKGYGFVHYETDEAASQAIKHVNGMLLNEKKVYVG 221          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: PABP_MAGGR (Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe grisea GN=PAB1 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.492e-13
Identity = 48/177 (27.12%), Postives = 89/177 (50.28%), Query Frame = 2
Query:   95 PDASSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNGVLCSTRPMRIG 625
            P AS+    SL++G+L P + E+ +  +F   G   S +V R+  T  S GY ++ + + A  E+ L+  N T +    +  R+ W+      R+   G    +F+ +L   + +  L +TF A + ++   KV  D   G SKGYGFV +  +    +++  +NG+L + + + +G
Sbjct:   57 PQASA----SLYVGELDPSVTEAMLFELFSQIGSVASIRVCRDAVTRRSLGYAYVNYNTTADGEKALEELNYTLIKG--RPCRIMWSQRDPALRKTGQG---NVFIKNLDVAIDNKALHDTF-AAFGNILSCKVAQDE-NGNSKGYGFVHYETDEAASQAIKHVNGMLLNEKKVYVG 222          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV2_XENTR (ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.492e-13
Identity = 45/163 (27.61%), Postives = 85/163 (52.15%), Query Frame = 2
Query:  104 SSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            + D   +L +  L   M +  + S+FG  GE  S K++R+K T  S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   62 TEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNG 216          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV2_PONAB (ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.492e-13
Identity = 45/163 (27.61%), Postives = 85/163 (52.15%), Query Frame = 2
Query:  104 SSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            + D   +L +  L   M +  + S+FG  GE  S K++R+K T  S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   34 TEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNG 188          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV2_MOUSE (ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.492e-13
Identity = 45/163 (27.61%), Postives = 85/163 (52.15%), Query Frame = 2
Query:  104 SSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            + D   +L +  L   M +  + S+FG  GE  S K++R+K T  S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   34 TEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNG 188          
BLAST of CN185528 vs. ExPASy Swiss-Prot
Match: ELAV2_HUMAN (ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.492e-13
Identity = 45/163 (27.61%), Postives = 85/163 (52.15%), Query Frame = 2
Query:  104 SSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAAERVLQTFNGTQMPSTEQNFRLNWATYGAGERRQDDGPDFTIFVGDLAADVTDYVLQETFRAVYSSVKGAKVVTDRTTGRSKGYGFVRFGDESEQLRSMTEMNG 592
            + D   +L +  L   M +  + S+FG  GE  S K++R+K T  S GYGF+ ++    AE+ + T NG ++ +  +  ++++A   +   R     D  ++V  L   +T   L++ F + Y  +  ++++ D+ TG S+G GF+RF    E   ++  +NG
Sbjct:   34 TEDSKTNLIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQT--KTIKVSYARPSSASIR-----DANLYVSGLPKTMTQKELEQLF-SQYGRIITSRILVDQVTGISRGVGFIRFDKRIEAEEAIKGLNG 188          
The following BLAST results are available for this feature:
BLAST of CN185528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 107
Match NameE-valueIdentityDescription
PABP_PICGU1.461e-1328.09Polyadenylate-binding protein, cytoplasmic and nuc... [more]
EPABA_XENLA1.461e-1328.80Embryonic polyadenylate-binding protein A OS=Xenop... [more]
ELAV4_RAT1.461e-1328.05ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4... [more]
ELAV4_MOUSE1.461e-1328.05ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1... [more]
PABP_NEUCR1.908e-1328.25Polyadenylate-binding protein, cytoplasmic and nuc... [more]
PABP_MAGGR2.492e-1327.12Polyadenylate-binding protein, cytoplasmic and nuc... [more]
ELAV2_XENTR2.492e-1327.61ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl... [more]
ELAV2_PONAB2.492e-1327.61ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2... [more]
ELAV2_MOUSE2.492e-1327.61ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2... [more]
ELAV2_HUMAN2.492e-1327.61ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001H18_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001H18, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185528 ID=CN185528|Name=CN185528|organism=Citrus sinensis|type=EST|length=625bp
GCAACAACATCAAACTCCGGTGCCACCTCCGGTTGGATGGACTCCGCAGC
CGGTGCCTCCTCCATCTCAGCAGACGCAGCCCTACGGTGTCGCCCCCGAT
GCTTCCTCCGACGGGATCCGTTCTTTGTGGATCGGAGACTTGCAGCCGTG
GATGGAGGAGAGTTATATCGCCAGCATCTTCGGCCATACTGGAGAGTTTG
TTTCAGGAAAGGTTATTCGCAACAAGCAAACAAATTTTTCAGAGGGTTAT
GGTTTTATTGAGTTTGTTAGTCATGCTGCTGCAGAGAGGGTTTTGCAGAC
TTTTAATGGCACCCAAATGCCAAGCACTGAGCAAAACTTCAGACTGAATT
GGGCAACCTATGGGGCTGGTGAGAGGCGTCAAGATGATGGTCCTGATTTT
ACAATTTTTGTGGGAGATTTGGCTGCCGATGTAACTGACTATGTGCTACA
AGAAACATTTAGAGCTGTCTACTCGTCAGTGAAGGGTGCTAAAGTGGTCA
CTGATAGAACCACTGGACGCTCTAAGGGGTATGGTTTTGTGAGATTTGGG
GATGAAAGTGAACAATTGCGTTCCATGACCGAAATGAATGGCGTGCTCTG
CTCTACTAGACCTATGCGGATTGGG
back to top