CN185397

Overview
NameCN185397
Unique NameCN185397
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length742
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6857 contig Csv1_Contig6857:25..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA9 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.686e-18
Identity = 53/152 (34.87%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAA2 (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.686e-18
Identity = 53/152 (34.87%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I  I+ ++V V   ++G  +E ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTIIKKQVPVCCFTFGIPNESIIERLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAAW (Probable 2-nitropropane dioxygenase OS=Staphylococcus aureus (strain MW2) GN=MW0803 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.508e-18
Identity = 53/152 (34.87%), Postives = 87/152 (57.24%), Query Frame = 3
Query:  252 NIKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH---------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            +I   + ++V V   ++G  SE ++     A +K++    S DEA     AG+DAI+ QG EAGGH          +   G ISL+P +VD++    IP+IAAGGI+D RG +A++ LGA+G+ + T F+ S++S A    +  ++   +T+
Sbjct:  117 HIDTTIKKQVPVCCFTFGIPSESIIKRLKEANIKLIGTATSVDEAIANEKAGMDAIVAQGSEAGGHRGSFLKPKNQLPMVGTISLVPQIVDVVS---IPVIAAGGIMDGRGVLASIVLGAEGVQMGTAFLTSQDSNASELLRDAIINSKETD 265          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAHJ (Probable 2-nitropropane dioxygenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2032 PE=3 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.615e-17
Identity = 56/174 (32.18%), Postives = 97/174 (55.75%), Query Frame = 3
Query:  255 IKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH------VIGQD----GLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE--YTDVFGRARWPGAPHRVLQT 740
            I+ ++  +V V   ++G  S+E++ +   A + ++    + DEA    +AG+D ++ QG EAGGH         Q     G +SL+P +VD +    IP++AAGG++D RG +A+  LGAQG+ + T F+ +EES A+   K+ ++   +T+   TDVF      G  +  ++T
Sbjct:  118 IQTVIKYRVPVCCFTFGIPSKEIIEQLKGAKITLIGTATTVDEAIANEHAGMDIVVAQGSEAGGHRGSFLTTNNQREPLIGTMSLIPQIVDHVS---IPVVAAGGVMDGRGILASQILGAQGVQMGTAFLTTEESGANQLVKQAVLHSKETDTIVTDVFSGKSARGINNEFVET 288          
BLAST of CN185397 vs. ExPASy Swiss-Prot
Match: 2NPD_STAS1 (Probable 2-nitropropane dioxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 5.600e-16
Identity = 50/152 (32.89%), Postives = 86/152 (56.58%), Query Frame = 3
Query:  255 IKAILSEKVAVLQVSWGEYSEELVLEAHSAGVKVVPQVGSFDEARKAVNAGVDAIIVQGREAGGH----------VIGQDGLISLLPMVVDLIGDRDIPIIAAGGIVDARGYVAALSLGAQGICLCTRFVASEESYAHPEYKRKLVEMDKTE 680
            I  ++ + V  +  ++G   + ++ +     +K++    S +EA    +AG+D +I QG EAGGH          +    G +SL+P +VD I   +IP++AAGGI+D RG VA++ LGA+G+ + T F+ S+ES A   YK  + +  +T+
Sbjct:  118 IDLVIEKGVPAVSFTFGIPEQTVIEKLKERHIKLIGTATSVEEAIANESAGMDMVIAQGSEAGGHRGAFSETASQLTPLIGTMSLVPQMVDQI---NIPVVAAGGIMDGRGLVASMVLGAEGVQMGTAFLTSDESGASQLYKHAISQSKETD 266          
The following BLAST results are available for this feature:
BLAST of CN185397 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
2NPD_STAA92.686e-1834.87Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAA22.686e-1834.87Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAAW3.508e-1834.87Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAHJ6.615e-1732.18Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]
2NPD_STAS15.600e-1632.89Probable 2-nitropropane dioxygenase OS=Staphylococ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001E10_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185397 ID=CN185397|Name=CN185397|organism=Citrus sinensis|type=EST|length=742bp
ATTTGAAGTTTACTCTAATGGGTTGGAGAGGAATGCTGGCTTTCAAGTAT
GGGATTGTTCAGGCACCATTGGGACCTGATATTTCAGGCCCGGAGCTTGT
AGCTGCTGTTGCTAATGCCGGTGGTCTTGGTCTTCTTAGAGCCCCCGATT
GGGAAGCACCAGATTACTTGAGGGATCTGATAAGGAAGACAAGATCATTA
ACAGAGCGACCATTTGGGGTTGGTGTGGTTCTAGCATTTCCCCACAACGA
AAATATAAAGGCTATACTTAGTGAAAAAGTAGCAGTTTTGCAAGTTTCCT
GGGGTGAATATTCAGAGGAGCTCGTTCTTGAAGCTCATAGTGCTGGAGTC
AAAGTTGTCCCCCAAGTTGGGAGTTTTGACGAAGCAAGAAAAGCAGTTAA
CGCAGGTGTAGATGCAATTATAGTCCAAGGACGTGAAGCTGGGGGCCATG
TAATTGGACAGGATGGTTTGATTTCCTTATTGCCAATGGTGGTTGATCTT
ATCGGGGATCGAGATATTCCAATAATTGCTGCAGGTGGTATTGTGGATGC
ACGTGGTTATGTTGCAGCCCTGTCTCTTGGTGCTCAAGGCATCTGCTTAT
GCACAAGGTTTGTGGCAAGTGAGGAAAGCTATGCGCATCCTGAGTACAAG
AGAAAGTTGGTTGAAATGGACAAAACTGAATATACAGATGTATTTGGCAG
GGCAAGATGGCCCGGTGCACCCCACCGTGTGCTGCAAACACC
back to top