CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_BACHD (Glutathione peroxidase homolog bsaA OS=Bacillus halodurans GN=bsaA PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 8.831e-34
Identity = 65/117 (55.56%), Postives = 86/117 (73.50%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y EL  LY+ YK+QG  +L FP NQF  QEPGD+ +I  F    +   FPIF+KV VNG  A PL+++L S +GGLF + IKWNF+KFL+D+ GNVV+RYAP+TSP+ I+ DI++LL
Sbjct:   41 YEELQILYETYKDQGFTVLGFPSNQFMNQEPGDHNEIAAFCERNYGVSFPIFEKVKVNGKEAHPLFQYLTSQQGGLFTEKIKWNFTKFLIDRSGNVVKRYAPSTSPIKIKDDIEELL 157          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_BACSU (Glutathione peroxidase homolog bsaA OS=Bacillus subtilis GN=bsaA PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 3.710e-32
Identity = 65/121 (53.72%), Postives = 83/121 (68.60%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFG-DSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            S   +L +LYD Y+ +GLEIL FPCNQF  QEPG+   IQEF  T +   FP+F KVDVNG NA PL+ +L     G+ G  +IKWNF+KF+VD+ G +V RY+P T+P  +E DI KLLE
Sbjct:   39 SQLKQLQELYDTYQQEGLEILGFPCNQFMNQEPGEEADIQEFCETNYGVTFPMFSKVDVNGKNAHPLFVYLTEHAKGMLGTKAIKWNFTKFIVDRNGEIVGRYSPNTNPKELEDDIVKLLE 159          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPO_LACLA (Glutathione peroxidase OS=Lactococcus lactis subsp. lactis GN=gpo PE=3 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 4.846e-32
Identity = 61/114 (53.51%), Postives = 81/114 (71.05%), Query Frame = 2
Query:   23 LSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            L +LY+ YK+QGLEIL FPCNQF  Q+ G+N +I EF    +   FP+F K+ VNG  A PLY+ LK    G    +IKWNF+KFL+D+EGNV+ER+AP T P  +E++I+KLL
Sbjct:   44 LEKLYENYKDQGLEILGFPCNQFVNQDAGENSEINEFCQLNYGVTFPMFQKIKVNGKEAHPLYQFLKKEAKGALSGTIKWNFTKFLIDREGNVIERFAPKTEPKEMEEEIQKLL 157          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_YEAST (Glutathione peroxidase 2 OS=Saccharomyces cerevisiae GN=GPX2 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 64/118 (54.24%), Postives = 81/118 (68.64%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFG-DSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            Y EL +LY KY+++G  IL FPCNQFG QEPG +EQI EF    +   FPI  K+DVNG NA  +Y +LKS K GL G   IKWNF KFLVD  G VV+R++  T P S++++I+ LL
Sbjct:   43 YKELEELYKKYQDKGFVILGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLGFKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLL 160          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAAW (Glutathione peroxidase homolog bsaA OS=Staphylococcus aureus (strain MW2) GN=bsaA PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 59/119 (49.58%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            S +  L  LY+KYK+QG  IL FPCNQFG QEPG  E+  +     +   FP+  K+DV G++  PL+++L +++ G F + IKWNF+KFLVD+EGNVV+R+AP   P+ IE++I+KLL
Sbjct:   40 SQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAAS (Glutathione peroxidase homolog bsaA OS=Staphylococcus aureus (strain MSSA476) GN=bsaA PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 59/119 (49.58%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            S +  L  LY+KYK+QG  IL FPCNQFG QEPG  E+  +     +   FP+  K+DV G++  PL+++L +++ G F + IKWNF+KFLVD+EGNVV+R+AP   P+ IE++I+KLL
Sbjct:   40 SQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAAR (Glutathione peroxidase homolog bsaA OS=Staphylococcus aureus (strain MRSA252) GN=bsaA PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 59/119 (49.58%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            S +  L  LY+KYK+QG  IL FPCNQFG QEPG  E+  +     +   FP+  K+DV G++  PL+++L +++ G F + IKWNF+KFLVD+EGNVV+R+AP   P+ IE++I+KLL
Sbjct:   40 SQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAAN (Glutathione peroxidase homolog bsaA OS=Staphylococcus aureus (strain N315) GN=bsaA PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 59/119 (49.58%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            S +  L  LY+KYK+QG  IL FPCNQFG QEPG  E+  +     +   FP+  K+DV G++  PL+++L +++ G F + IKWNF+KFLVD+EGNVV+R+AP   P+ IE++I+KLL
Sbjct:   40 SQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAAM (Glutathione peroxidase homolog bsaA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=bsaA PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 59/119 (49.58%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            S +  L  LY+KYK+QG  IL FPCNQFG QEPG  E+  +     +   FP+  K+DV G++  PL+++L +++ G F + IKWNF+KFLVD+EGNVV+R+AP   P+ IE++I+KLL
Sbjct:   40 SQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL 158          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: BSAA_STAAC (Glutathione peroxidase homolog bsaA OS=Staphylococcus aureus (strain COL) GN=bsaA PE=3 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 8.265e-32
Identity = 59/119 (49.58%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            S +  L  LY+KYK+QG  IL FPCNQFG QEPG  E+  +     +   FP+  K+DV G++  PL+++L +++ G F + IKWNF+KFLVD+EGNVV+R+AP   P+ IE++I+KLL
Sbjct:   40 SQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL 158          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
BSAA_BACHD8.831e-3455.56Glutathione peroxidase homolog bsaA OS=Bacillus ha... [more]
BSAA_BACSU3.710e-3253.72Glutathione peroxidase homolog bsaA OS=Bacillus su... [more]
GPO_LACLA4.846e-3253.51Glutathione peroxidase OS=Lactococcus lactis subsp... [more]
GPX2_YEAST8.265e-3254.24Glutathione peroxidase 2 OS=Saccharomyces cerevisi... [more]
BSAA_STAAW8.265e-3249.58Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
BSAA_STAAS8.265e-3249.58Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
BSAA_STAAR8.265e-3249.58Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
BSAA_STAAN8.265e-3249.58Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
BSAA_STAAM8.265e-3249.58Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]
BSAA_STAAC8.265e-3249.58Glutathione peroxidase homolog bsaA OS=Staphylococ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top