CN185247

Overview
NameCN185247
Unique NameCN185247
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length430
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2542 contig Csv1_Contig2542:360..789. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX7_BOVIN (Glutathione peroxidase 7 OS=Bos taurus GN=GPX7 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.513e-17
Identity = 46/121 (38.02%), Postives = 63/121 (52.07%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T+ +Y  L QL          +LAFPCNQFG QEP  N++I+ FA   +   FP+F K+ V G  A P +K+L  +     G    WNF K+LV  +G V+  + PT S   I   I  L+
Sbjct:   59 TDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTETS----GKEPTWNFWKYLVAPDGKVIGAWDPTVSVEEIRPQITALV 175          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX8A_XENLA (Probable glutathione peroxidase 8-A OS=Xenopus laevis GN=gpx8-A PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.371e-17
Identity = 43/119 (36.13%), Postives = 65/119 (54.62%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            +NY  L +L+ ++      +LAFPCNQFG  EPG N++I   A   +   FP+F K+ + G  A P Y+ L  S         +WNF K+LVD +G VV+ + P  +  SI  ++  L+
Sbjct:   84 ANYRSLQELHREFGPSHFTVLAFPCNQFGESEPGTNQEIGALAKRNYGVTFPMFSKIKILGSEAEPAYRFLVDST----KKEPRWNFWKYLVDPQGQVVKYWRPDETAESIRPEVASLV 198          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_RAT (Glutathione peroxidase 1 OS=Rattus norvegicus GN=Gpx1 PE=1 SV=4)

HSP 1 Score: 83.9593 bits (206), Expect = 2.854e-16
Identity = 52/145 (35.86%), Postives = 72/145 (49.66%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YTE++ L  +   +GL +L FPCNQFG QE G NE+I       R    F+  F +F+K +VNG+ A PL+  L+++      D                    I WNF KFLV  +G  V RY+     + IE DI+ LL
Sbjct:   50 TTRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIEALL 194          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX8_BOVIN (Probable glutathione peroxidase 8 OS=Bos taurus GN=GPX8 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.084e-15
Identity = 43/121 (35.54%), Postives = 64/121 (52.89%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T+ NY  L +L+ ++      +LAFPCNQFG  EP  ++++  FA   F   FPIF K+ + G  A P ++ L  S         +WNF K+LV+ EG VV+ + P      I  +I  L+
Sbjct:   82 TDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSKEVVSFARNNFGVTFPIFHKIKILGSEAEPAFRFLVDSS----KKEPRWNFWKYLVNPEGQVVKTWRPEEPIEVIRPEIAALI 198          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX8_HUMAN (Probable glutathione peroxidase 8 OS=Homo sapiens GN=GPX8 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.416e-15
Identity = 42/121 (34.71%), Postives = 64/121 (52.89%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T+ NY  L +L+ ++      +LAFPCNQFG  EP  +++++ FA   +   FPIF K+ + G    P ++ L  S         +WNF K+LV+ EG VV+ + P      I  DI  L+
Sbjct:   82 TDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSS----KKEPRWNFWKYLVNPEGQVVKFWKPEEPIEVIRPDIAALV 198          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX1_MOUSE (Glutathione peroxidase 1 OS=Mus musculus GN=Gpx1 PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.416e-15
Identity = 51/145 (35.17%), Postives = 73/145 (50.34%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSK-------------------GGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T  +YTE++ L  +   +GL +L FPCNQFG QE G NE+I       R    F+  F +F+K +VNG+ A PL+  L+++                      +  + I WNF KFLV  +G  V RY+     + IE DI+ LL
Sbjct:   50 TIRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIETLL 194          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX6_HUMAN (Glutathione peroxidase 6 OS=Homo sapiens GN=GPX6 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 2.416e-15
Identity = 50/140 (35.71%), Postives = 74/140 (52.86%), Query Frame = 2
Query:    8 SNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI---QEFAC--TRFKAEFPIFDKVDVNGDNAAPLYKHLKSS---KGGLFGDS------------IKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            + Y EL+ L ++ KN G+ +LAFPCNQFG QEPG N +I    ++ C  + F   F +F+K DVNG+    ++  LK+S      L G S            I+WNF KFLV  +G  V  +       +++ DI + L+
Sbjct:   77 AQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLKYVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIRWNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLK 216          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX2_RAT (Glutathione peroxidase 2 OS=Rattus norvegicus GN=Gpx2 PE=1 SV=3)

HSP 1 Score: 80.1073 bits (196), Expect = 4.121e-15
Identity = 50/146 (34.25%), Postives = 72/146 (49.32%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQI-QEFACTR----FKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGD-------------------SIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLLE 367
            T  +YT+L++L  ++  + L +L FPCNQFG QE   NE+I       R    F+  F +  K DVNG N  P++ +LK      + D                    + WNF KFL+  EG    RY+ T   ++IE DIK+LL+
Sbjct:   43 TTRDYTQLNELQCRFPRR-LVVLGFPCNQFGHQENCQNEEILNSLKYVRHGGGFQPTFSLTQKCDVNGQNQHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEPDIKRLLK 187          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX8_MOUSE (Probable glutathione peroxidase 8 OS=Mus musculus GN=Gpx8 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.029e-15
Identity = 38/121 (31.40%), Postives = 66/121 (54.55%), Query Frame = 2
Query:    2 TNSNYTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFKAEFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGNVVERYAPTTSPLSIEKDIKKLL 364
            T+ +Y  L +L+ ++      +LAFPCNQFG  EP  +++++ FA   +   FPIF K+ + G  A P ++ +  S         +WNF K+LV+ EG VV+ + P     +I   + +++
Sbjct:   82 TDKSYQTLRELHKEFGPYHFNVLAFPCNQFGESEPKSSKEVESFARQNYGVTFPIFHKIKILGPEAEPAFRFIVDSS----KKEPRWNFWKYLVNPEGQVVKFWRPEEPLEAIRPHVSQMI 198          
BLAST of CN185247 vs. ExPASy Swiss-Prot
Match: GPX3_CAEEL (Glutathione peroxidase OS=Caenorhabditis elegans GN=C11E4.2 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.029e-15
Identity = 47/126 (37.30%), Postives = 66/126 (52.38%), Query Frame = 2
Query:   14 YTELSQLYDKYKNQGLEILAFPCNQFGAQEPGDNEQIQEFACTRFK--------AEFPIFDKVDVNGDNAAPLYKHLKSS------KGGLFGD---------SIKWNFSKFLVDKEGNVVERYAPT 322
            YT+ + + +KY+ QGL ++AFPCNQF  QEP +N ++     T  +         E  I+ K+DVNGDN  PLY+ +K S      K G   +          I WNF KFL+D+ G    R+ PT
Sbjct:   79 YTDFNPMLEKYQAQGLTLVAFPCNQFYLQEPAENHELMN-GLTYVRPGNGWTPHQELHIYGKIDVNGDNHHPLYEFVKESCPQTVDKIGKTDELMYNPVRPSDITWNFEKFLIDRNGQPRFRFHPT 203          
The following BLAST results are available for this feature:
BLAST of CN185247 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
GPX7_BOVIN1.513e-1738.02Glutathione peroxidase 7 OS=Bos taurus GN=GPX7 PE=... [more]
GPX8A_XENLA3.371e-1736.13Probable glutathione peroxidase 8-A OS=Xenopus lae... [more]
GPX1_RAT2.854e-1635.86Glutathione peroxidase 1 OS=Rattus norvegicus GN=G... [more]
GPX8_BOVIN1.084e-1535.54Probable glutathione peroxidase 8 OS=Bos taurus GN... [more]
GPX8_HUMAN1.416e-1534.71Probable glutathione peroxidase 8 OS=Homo sapiens ... [more]
GPX1_MOUSE1.416e-1535.17Glutathione peroxidase 1 OS=Mus musculus GN=Gpx1 P... [more]
GPX6_HUMAN2.416e-1535.71Glutathione peroxidase 6 OS=Homo sapiens GN=GPX6 P... [more]
GPX2_RAT4.121e-1534.25Glutathione peroxidase 2 OS=Rattus norvegicus GN=G... [more]
GPX8_MOUSE7.029e-1531.40Probable glutathione peroxidase 8 OS=Mus musculus ... [more]
GPX3_CAEEL7.029e-1537.30Glutathione peroxidase OS=Caenorhabditis elegans G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A17_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185247 ID=CN185247|Name=CN185247|organism=Citrus sinensis|type=EST|length=430bp
GACCAATTCAAACTACACTGAGCTGAGTCAGTTGTACGACAAGTACAAGA
ATCAAGGCTTGGAGATTCTGGCCTTTCCTTGTAATCAGTTTGGAGCTCAA
GAGCCAGGAGACAATGAACAGATTCAAGAATTTGCATGCACTCGCTTTAA
GGCTGAGTTTCCCATATTTGATAAGGTTGATGTTAATGGTGATAATGCTG
CTCCTTTATACAAGCATCTGAAATCCAGCAAAGGTGGACTTTTTGGAGAC
AGCATCAAGTGGAACTTTTCCAAGTTCTTGGTGGATAAGGAGGGGAATGT
TGTTGAGCGTTATGCCCCCACCACTAGCCCTCTGAGCATTGAGAAGGATA
TAAAGAAACTTCTGGAGACTGCTTAACCGCTGCTACAACTTGCATGATCA
GCTTCTTGCTAATAAAACTAGAGTATCATG
back to top