CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_PORYE (50S ribosomal protein L1, chloroplastic OS=Porphyra yezoensis GN=rpl1 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.781e-44
Identity = 78/139 (56.12%), Postives = 113/139 (81.29%), Query Frame = -1
Query:  349 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD+ G ++LI++I  G ++FDKLIA+PD+M  +A LG++LGPRGLMP+PKAGTVT ++ +A+ EFK GKVEYR D+TGI+H+PFGK+ FS++DL++N     +SI+ NKP GAKG YWK+ ++ S+MGPSI+++I  +L
Sbjct:   91 ADVSGSEELIDEILKGRLDFDKLIATPDVMPLIAKLGRVLGPRGLMPSPKAGTVTLDVAKAVNEFKGGKVEYRVDRTGIIHVPFGKSSFSQEDLVLNLQTIKESIDRNKPSGAKGKYWKTFFLSSTMGPSIQIDITSLL 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_CYAME (50S ribosomal protein L1, chloroplastic OS=Cyanidioschyzon merolae GN=rpl1 PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.781e-44
Identity = 84/137 (61.31%), Postives = 106/137 (77.37%), Query Frame = -1
Query:  355 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKE 765
            ADLVG DDL  QI    + FD LIA+PDMM  +A LGKILGPRGLMP+PK+GTVTTN+ +AI+ F++G++EYR DKTGIVH+ FG+ DF+E  L  N +A  +S+E NKP GA G+YWKS  I +SM PSIRLNI++
Sbjct:   86 ADLVGSDDLCAQIAQSIINFDCLIATPDMMPTLAKLGKILGPRGLMPSPKSGTVTTNVAEAIQAFRRGQIEYRTDKTGIVHLAFGRMDFNEQHLYDNLVAIKESVETNKPSGASGLYWKSFAIATSMSPSIRLNIQQ 222          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNS3 (50S ribosomal protein L1 OS=Synechococcus sp. (strain CC9311) GN=rplA PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.511e-43
Identity = 84/140 (60.00%), Postives = 108/140 (77.14%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            A+L G +DL+E I  G M FD LIA+PDMM KVA LG++LGPRGLMPNPKAGTVTT++  AI+EFK GK+E+RAD+TGIVH+ FGKA F+ + LL N     ++I+ NKP GAKG YWKS Y+ S+MGPS+ ++I  + D
Sbjct:   91 AELSGDEDLVEAISKGEMNFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLASAIQEFKAGKLEFRADRTGIVHVRFGKASFTAEALLENLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDIALLQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_CYACA (50S ribosomal protein L1, chloroplastic OS=Cyanidium caldarium GN=rpl1 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.973e-43
Identity = 78/137 (56.93%), Postives = 109/137 (79.56%), Query Frame = -1
Query:  352 DLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 762
            D+VG  DL+E I  GF+EFD+L+ +PDMM  +A +GKILGPRGLMP+PK+G+VT++I  AI+EFKKGK+EYR DK+GIVH   GK DF+ +DLL N +A  KSI+ N+P GAKG YWK+ Y+C++M P+I+++  ++
Sbjct:   94 DIVGSKDLVESIANGFLEFDQLLTTPDMMPVIAKVGKILGPRGLMPSPKSGSVTSDIYNAIQEFKKGKLEYRTDKSGIVHSIIGKIDFTAEDLLNNLIAIKKSIDQNRPNGAKGKYWKNMYLCTTMSPAIKIDFNKL 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNPX (50S ribosomal protein L1 OS=Synechococcus sp. (strain WH8102) GN=rplA PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.365e-43
Identity = 83/140 (59.29%), Postives = 107/140 (76.43%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            A+L G +DL+E I  G MEFD LIA+PDMM KVA LG++LGPRGLMPNPKAGTVT ++  AI+EFK GK+E+RAD+TGIVH+ FGKA F+ + LL N     ++I+ NKP GAKG YWKS Y+ S+MGPS+ ++   + D
Sbjct:   91 AELAGDEDLVETIAKGEMEFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTIDLAGAIQEFKAGKLEFRADRTGIVHVRFGKASFTAEALLQNLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDFSALQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_PORPU (50S ribosomal protein L1, chloroplastic OS=Porphyra purpurea GN=rpl1 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.365e-43
Identity = 78/139 (56.12%), Postives = 111/139 (79.86%), Query Frame = -1
Query:  349 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD+ G ++LI++I  G ++FDKLIA+PD+M  +A LG++LGPRGLMP+PKAGTVT +I ++I EFK GKVEYR D+TGI+H+PFGK+ F E+DL++N      SI+ NKP G+KG YWK+ ++ S+MGPSI+++I  +L
Sbjct:   91 ADISGSEELIDEISKGRLDFDKLIATPDIMPLIAKLGRVLGPRGLMPSPKAGTVTLDITKSINEFKGGKVEYRVDRTGIIHVPFGKSSFPEEDLVMNLQTIKDSIDKNKPSGSKGKYWKTFFLSSTMGPSIQIDITSLL 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNS9 (50S ribosomal protein L1 OS=Synechococcus sp. (strain CC9902) GN=rplA PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 4.395e-43
Identity = 82/138 (59.42%), Postives = 106/138 (76.81%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            A+L G +DL+E I  G M FD LIA+PDMM KVA LG++LGPRGLMPNPKAGTVTT++  AI++FK GK+E+RAD+TGIVH+ FGKA F+ D LL N     ++I+ NKP GAKG YWKS Y+ S+MGPS+ ++   +
Sbjct:   91 AELAGDEDLVEAISKGEMNFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAIKDFKAGKLEFRADRTGIVHVRFGKASFTADALLENLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDFSAL 228          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_GLOVI (50S ribosomal protein L1 OS=Gloeobacter violaceus GN=rplA PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.497e-43
Identity = 82/143 (57.34%), Postives = 111/143 (77.62%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+ G ++LIE+I+GGFMEFD +IA+PD+M +VA LGK+LGPRGLMP+PK GTVT ++  AI EFK GK+E+RAD+TGIVHIPFGK  F+ + L+ N  +   +I+  KP GAKG YW++ +I S+MGPSI ++I  + D KL
Sbjct:   92 ADIAGSEELIERIQGGFMEFDLMIATPDIMPQVARLGKLLGPRGLMPSPKGGTVTMDLVGAIREFKAGKLEFRADRTGIVHIPFGKVSFTPEALMDNLKSVQDAIDRAKPSGAKGRYWRTFHIKSTMGPSIEIDINALRDLKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_THAPS (50S ribosomal protein L1, chloroplastic OS=Thalassiosira pseudonana GN=rpl1 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.497e-43
Identity = 77/135 (57.04%), Postives = 109/135 (80.74%), Query Frame = -1
Query:  361 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNI 765
            AD+VG  +LI+ I  G + FD L+A+PDMM K+A LG++LGP+GLMP+PK+GTV+TN+ + + +FKKGK EY+ADKTG+VH+ FGKA+FS+D L+ N  +  +SIE N+P G KG Y+KS +IC+SMGPSI+L++
Sbjct:   92 ADIVGSQELIDDISQGNLNFDLLVATPDMMPKLAKLGRVLGPKGLMPSPKSGTVSTNLTETLSDFKKGKFEYKADKTGVVHVNFGKANFSKDQLMENLTSLYQSIEQNRPSGVKGKYFKSLFICTSMGPSIQLDL 226          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_CYAPA (50S ribosomal protein L1, cyanelle OS=Cyanophora paradoxa GN=rpl1 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 7.497e-43
Identity = 82/146 (56.16%), Postives = 112/146 (76.71%), Query Frame = -1
Query:  328 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKLPSN 765
            ADLVG ++LI++I+ G ++FD LIA+PDMM +VA LG++LGPRGLMP+PK GTVT ++ QAI +FK GK+E+R D+TGIVH+ FGKA+FSE+ LL N  A  ++++ N+P G KG YWKS YI S+M PSI ++   + D KL  N
Sbjct:   91 ADLVGAEELIDEIQNGRLDFDCLIATPDMMPQVAKLGRVLGPRGLMPSPKGGTVTFDLAQAINDFKAGKLEFRNDRTGIVHVLFGKANFSEEALLGNLKAVQEAVDRNRPSGVKGKYWKSIYITSTMSPSIEVDYNLLRDLKLTEN 236          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RK1_PORYE6.781e-4456.1250S ribosomal protein L1, chloroplastic OS=Porphyr... [more]
RK1_CYAME6.781e-4461.3150S ribosomal protein L1, chloroplastic OS=Cyanidi... [more]
RL1_SYNS31.511e-4360.0050S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RK1_CYACA1.973e-4356.9350S ribosomal protein L1, chloroplastic OS=Cyanidi... [more]
RL1_SYNPX3.365e-4359.2950S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RK1_PORPU3.365e-4356.1250S ribosomal protein L1, chloroplastic OS=Porphyr... [more]
RL1_SYNS94.395e-4359.4250S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RL1_GLOVI7.497e-4357.3450S ribosomal protein L1 OS=Gloeobacter violaceus ... [more]
RK1_THAPS7.497e-4357.0450S ribosomal protein L1, chloroplastic OS=Thalass... [more]
RK1_CYAPA7.497e-4356.1650S ribosomal protein L1, cyanelle OS=Cyanophora p... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top