CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNP2 (50S ribosomal protein L1 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplA PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.670e-42
Identity = 81/140 (57.86%), Postives = 109/140 (77.86%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            ADLVG ++LIE I+ G M+F+ LIA+PDMM KVA LG+ LGPRGLMP+PK GTVTT++  AI  FK GK E+RAD+ GIVH+ FGK+ F+ +DLL+N  A  ++I+ N+P GAKG YW+S Y+ +SMGPSI+++I  + D
Sbjct:   92 ADLVGSEELIEDIQKGMMDFEVLIATPDMMPKVARLGRQLGPRGLMPSPKGGTVTTDVATAIAAFKAGKQEFRADRAGIVHVLFGKSSFAAEDLLVNLKALQETIDRNRPSGAKGRYWRSIYVSASMGPSIQVDINALRD 231          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNJA (50S ribosomal protein L1 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplA PE=3 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.181e-42
Identity = 82/143 (57.34%), Postives = 111/143 (77.62%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD VG +DLIE+I  G ++FD LIA+PD+M +VA LG++LGPRGLMP+PK GTVT ++ QAI+EFK GK+EYRADKTGIVH+ FGK  F  + LL N  A  +SI+ N+P GAKG YW++ ++C++MGPSI ++I  + + KL
Sbjct:   92 ADRVGFEDLIEEIGKGVIDFDLLIATPDVMPQVAKLGRLLGPRGLMPSPKGGTVTMDLAQAIKEFKAGKLEYRADKTGIVHLIFGKCKFPVEALLENLKAVQESIDRNRPPGAKGKYWRALHVCATMGPSIEVDINALRELKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_ODOSI (50S ribosomal protein L1, chloroplastic OS=Odontella sinensis GN=rpl1 PE=3 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 4.860e-42
Identity = 79/139 (56.83%), Postives = 106/139 (76.26%), Query Frame = -1
Query:  349 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD VG DDLIE+I  G + FD LIA+PDMM K+A LG++LGP+GLMP+PK+GTV+T +   + EFKKGK EY+ADK G+VH+ FGK++F+   L+ N  A  KSIE N+P G KG Y+KS +IC++MGPSI+L++   L
Sbjct:   92 ADRVGSDDLIEEISQGNISFDLLIATPDMMPKLAKLGRVLGPKGLMPSPKSGTVSTTLTATLSEFKKGKFEYKADKAGVVHVSFGKSNFTHSQLMENLTALYKSIEQNRPSGVKGKYFKSLFICTTMGPSIQLDLNIFL 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNJB (50S ribosomal protein L1 OS=Synechococcus sp. GN=rplA PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 8.289e-42
Identity = 81/143 (56.64%), Postives = 110/143 (76.92%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD VG +DLIE+I  G M+FD LIA+PD+M +VA LG++LGPRGLMP+PK GTVT ++ QAI+EFK GK+EYRAD+TGIVH+ FGK  F  + LL N  A  +SI+ N+P GAKG YW++ ++ ++MGPSI ++I  + + KL
Sbjct:   92 ADRVGYEDLIEEISKGMMDFDLLIATPDVMPQVAKLGRLLGPRGLMPSPKGGTVTMDLAQAIKEFKAGKLEYRADRTGIVHLIFGKCKFPVEALLENLKAVQESIDRNRPSGAKGKYWRTLHVSATMGPSIEVDINALRELKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PROM4 (50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9211) GN=rplA PE=3 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.847e-41
Identity = 81/140 (57.86%), Postives = 105/140 (75.00%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            ADL G ++L++ I  G M FD LIA+PDMM KVA LG++LGPRGLMPNPK GTVT ++  AI+EFK GK+E+RADK GI+H+ FGKA F+ D LL N     ++I+ NKP GAKG +WK+ YI S+MGPSI ++I  + D
Sbjct:   91 ADLAGEEELVDSISKGEMGFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKTGTVTADLVGAIKEFKAGKLEFRADKAGIIHVRFGKASFNADALLENLKTLQETIDRNKPSGAKGRFWKTLYITSTMGPSIEVDIAALQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ANASK (50S ribosomal protein L1 OS=Anaeromyxobacter sp. (strain K) GN=rplA PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 7.017e-41
Identity = 80/138 (57.97%), Postives = 106/138 (76.81%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD+VG +DL E+I+GGFM+FDKLIA+PDMM  V  LGKILGPRGLMPNPK GTVT ++ +A++E K GKVE+R +K GIVH+PFGKA F  D L  NF A ++ I   KP+ AKGVY K+  + ++MGP I++++ E+
Sbjct:   92 ADIVGAEDLAEKIQGGFMDFDKLIATPDMMGVVGRLGKILGPRGLMPNPKVGTVTMDLARAVKEQKAGKVEFRVEKAGIVHVPFGKASFDPDKLKANFSAIMEVIYKAKPQTAKGVYVKNVTLSTTMGPGIKVDLAEL 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ANAD2 (50S ribosomal protein L1 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplA PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 7.017e-41
Identity = 80/138 (57.97%), Postives = 106/138 (76.81%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD+VG +DL E+I+GGFM+FDKLIA+PDMM  V  LGKILGPRGLMPNPK GTVT ++ +A++E K GKVE+R +K GIVH+PFGKA F  D L  NF A ++ I   KP+ AKGVY K+  + ++MGP I++++ E+
Sbjct:   92 ADIVGAEDLAEKIQGGFMDFDKLIATPDMMGVVGRLGKILGPRGLMPNPKVGTVTMDLARAVKEQKAGKVEFRVEKAGIVHVPFGKASFDPDKLKANFSAIMEVIYKAKPQTAKGVYVKNVTLSTTMGPGIKVDLAEL 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ANADE (50S ribosomal protein L1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplA PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 9.165e-41
Identity = 80/138 (57.97%), Postives = 106/138 (76.81%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD+VG +DL E+I+GGFM+FDKLIA+PDMM  V  LGKILGPRGLMPNPK GTVT ++ +A++E K GKVE+R +K GIVH+PFGKA F  + L  NF A ++ I   KP+ AKGVY K+  + ++MGP I+L++ E+
Sbjct:   92 ADIVGAEDLAEKIQGGFMDFDKLIATPDMMGVVGRLGKILGPRGLMPNPKVGTVTMDLARAVKEQKAGKVEFRVEKAGIVHVPFGKASFDPEKLKANFSAIMEVIYKAKPQTAKGVYVKNVTLSTTMGPGIKLDLAEL 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ANADF (50S ribosomal protein L1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplA PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.940e-40
Identity = 76/138 (55.07%), Postives = 106/138 (76.81%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD+VG +DL E+++GGFM+FDK++A+PDMM  V  LGK+LGPRGLMPNPK GTV+ +I +A++E K GKVE+R +K GIVH+PFGKA F  + L  NF A ++ I   KP+ AKGVY K+  + ++MGP I+L++ E+
Sbjct:   92 ADIVGAEDLAEKVQGGFMDFDKVLATPDMMGVVGRLGKVLGPRGLMPNPKVGTVSADIARAVKEQKAGKVEFRVEKAGIVHVPFGKASFEPEKLKANFSAIMEIIYKAKPQTAKGVYVKNVTLSTTMGPGIKLDLSEL 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RK1_PHATR (50S ribosomal protein L1, chloroplastic OS=Phaeodactylum tricornutum GN=rpl1 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 5.940e-40
Identity = 75/135 (55.56%), Postives = 106/135 (78.52%), Query Frame = -1
Query:  358 DLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIK 762
            D+VG D+LI QI  G + FD LIA+P+MM K+A LG++LGP+GLMP+PK+GTVT+ +   + EFKKGK EY+ADKTGIVH+ FGK++F+ + L+ N  A  +SIE N+P G KG Y+KS  IC++MGPS++L+++
Sbjct:   93 DIVGNDELIAQITQGQINFDLLIATPNMMPKLAKLGRMLGPKGLMPSPKSGTVTSTLQSTLTEFKKGKFEYKADKTGIVHVNFGKSNFTNEQLVENLKALYQSIEQNRPSGVKGKYFKSVSICTTMGPSVKLDLE 227          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RL1_SYNP21.670e-4257.8650S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RL1_SYNJA2.181e-4257.3450S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RK1_ODOSI4.860e-4256.8350S ribosomal protein L1, chloroplastic OS=Odontel... [more]
RL1_SYNJB8.289e-4256.6450S ribosomal protein L1 OS=Synechococcus sp. GN=r... [more]
RL1_PROM41.847e-4157.8650S ribosomal protein L1 OS=Prochlorococcus marinu... [more]
RL1_ANASK7.017e-4157.9750S ribosomal protein L1 OS=Anaeromyxobacter sp. (... [more]
RL1_ANAD27.017e-4157.9750S ribosomal protein L1 OS=Anaeromyxobacter dehal... [more]
RL1_ANADE9.165e-4157.9750S ribosomal protein L1 OS=Anaeromyxobacter dehal... [more]
RL1_ANADF5.940e-4055.0750S ribosomal protein L1 OS=Anaeromyxobacter sp. (... [more]
RK1_PHATR5.940e-4055.5650S ribosomal protein L1, chloroplastic OS=Phaeoda... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top