CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELPH (50S ribosomal protein L1 OS=Helicobacter pylori (strain HPAG1) GN=rplA PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.051e-36
Identity = 73/142 (51.41%), Postives = 99/142 (69.72%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VGGDDL E+IK G ++FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT +I +A+   K G+V +R DK G VH P GKA F E+ +  N L  VK+I   KP  AKG Y ++A +  +M PS+ L+ +E++D K
Sbjct:   93 ADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVSNAKSGQVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVSLDAQELMDIK 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELP2 (50S ribosomal protein L1 OS=Helicobacter pylori (strain P12) GN=rplA PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.051e-36
Identity = 73/142 (51.41%), Postives = 99/142 (69.72%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VGGDDL E+IK G ++FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT +I +A+   K G+V +R DK G VH P GKA F E+ +  N L  VK+I   KP  AKG Y ++A +  +M PS+ L+ +E++D K
Sbjct:   93 ADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVSNAKSGQVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVSLDAQELMDIK 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELHP (50S ribosomal protein L1 OS=Helicobacter hepaticus GN=rplA PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.051e-36
Identity = 71/142 (50.00%), Postives = 101/142 (71.13%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VG DDL E+IK G + FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT ++ +A+   K G+V +R DK GI+H P GKA F+E+ +L N L  V++I   KP  AKG Y +S+ +  +M P+I+L+ +E++D K
Sbjct:   93 ADVVGADDLAEEIKNGNINFDMVIATPDMMALVGKVGRILGPKGLMPNPKTGTVTIDVAKAVANAKSGQVNFRVDKKGIIHAPIGKASFNEEKILDNMLELVRAINRLKPTSAKGKYIRSSSLSLTMSPAIKLDSQELMDMK 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELPG (50S ribosomal protein L1 OS=Helicobacter pylori (strain G27) GN=rplA PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.985e-36
Identity = 73/142 (51.41%), Postives = 99/142 (69.72%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VGGDDL E+IK G ++FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT +I +A+   K G+V +R DK G VH P GKA F E+ +  N L  VK+I   KP  AKG Y ++A +  +M PS+ L+ +E++D K
Sbjct:   93 ADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVTNAKSGQVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVSLDAQELMDIK 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_BACSK (50S ribosomal protein L1 OS=Bacillus clausii (strain KSM-K16) GN=rplA PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.985e-36
Identity = 70/133 (52.63%), Postives = 94/133 (70.68%), Query Frame = -1
Query:  367 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRL 765
            AD VG DDLI +I  G+ +FD ++A+PDMM +V  LG++LGP+GLMPNPK GTVT ++ +A+EE K GKVEYR DK+G +H+P GK  F    LL NF   V+++   KP  AKG Y K+  + S+MGP IR+
Sbjct:   92 ADYVGEDDLINKINQGWFDFDVIVATPDMMAQVGRLGRVLGPKGLMPNPKTGTVTFDVTKAVEEIKAGKVEYRVDKSGNIHVPIGKVSFDTPKLLENFQTIVETLHKVKPAAAKGTYVKNIAVASTMGPGIRV 224          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_LYSSC (50S ribosomal protein L1 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplA PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 5.204e-36
Identity = 70/134 (52.24%), Postives = 97/134 (72.39%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VG  + I++I+ G+ +FD ++A+PDMM +V  LG++LGP+GLMPNPK GTVT ++ +AIEE K GKVEYRADK GI+H P GK  FS   L+ NFLA    ++  KP  AKG Y KS  I ++MGP+++++
Sbjct:   92 ADYVGDAEYIQKIQQGWFDFDVIVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAIEEIKAGKVEYRADKAGIIHAPIGKVSFSAAKLVENFLAVFDVVQKAKPAAAKGTYMKSVNITTTMGPAVKID 225          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_ACIBL (50S ribosomal protein L1 OS=Acidobacteria bacterium (strain Ellin345) GN=rplA PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 5.204e-36
Identity = 71/135 (52.59%), Postives = 95/135 (70.37%), Query Frame = -1
Query:  364 ADLVGGDDLIEQI-KGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VGG+D++E+I K G+ ++D +I++PDMM  V  LGK+LGPRGLMPNPK GTVTT++  A+ E K GKVE+R DKTG+VH+P GK  F  D L+ N    + S+   KP  AKG Y K  Y+ S+MGP I ++
Sbjct:   91 ADFVGGEDMVEKIAKEGWTDYDAVISTPDMMRSVGKLGKVLGPRGLMPNPKTGTVTTDVASAVREVKAGKVEFRTDKTGLVHVPVGKISFPPDKLVDNATTLITSVVKAKPSAAKGKYIKGCYLSSTMGPGISID 225          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PETMO (50S ribosomal protein L1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplA PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.797e-36
Identity = 72/139 (51.80%), Postives = 99/139 (71.22%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKG-GFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD VG DDLIE+I   G+ +FD  IA+PD+M K+  LGK+LGPRGLMP+PKAGTVT ++ QA++EFK GKVE R D+TG +HIP GK  F +DDL  N ++A   +   KP+ +KG + + A I S+MGP I +++  +
Sbjct:   92 ADFVGSDDLIEKINNEGWTDFDVAIATPDIMRKIGRLGKVLGPRGLMPSPKAGTVTDDVAQAVKEFKAGKVEVRNDRTGNIHIPIGKVSFDKDDLKENLISAFDQLTKMKPENSKGKFIRKAVIASTMGPGINIDLSSL 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DESHY (50S ribosomal protein L1 OS=Desulfitobacterium hafniense (strain Y51) GN=rplA PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.797e-36
Identity = 68/134 (50.75%), Postives = 96/134 (71.64%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VG +D+I +I+ G+  FD ++A+PDMM  V  LG++LGP+GLMPNPK GTVT ++ +A++E K GK+EYRADK GI+H P GK  FSE+ L  N+   V+++   KP  AKG Y +S  + S+MGP +R+N
Sbjct:   92 ADFVGAEDMIAKIEQGWFGFDVVVATPDMMGMVGKLGRVLGPKGLMPNPKTGTVTFDVAKAVKEIKAGKIEYRADKAGIIHAPIGKVSFSEEQLYQNYKVLVETLVKAKPAAAKGQYIRSVTVSSTMGPGVRIN 225          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DESHD (50S ribosomal protein L1 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplA PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 6.797e-36
Identity = 68/134 (50.75%), Postives = 96/134 (71.64%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VG +D+I +I+ G+  FD ++A+PDMM  V  LG++LGP+GLMPNPK GTVT ++ +A++E K GK+EYRADK GI+H P GK  FSE+ L  N+   V+++   KP  AKG Y +S  + S+MGP +R+N
Sbjct:   92 ADFVGAEDMIAKIEQGWFGFDVVVATPDMMGMVGKLGRVLGPKGLMPNPKTGTVTFDVAKAVKEIKAGKIEYRADKAGIIHAPIGKVSFSEEQLYQNYKVLVETLVKAKPAAAKGQYIRSVTVSSTMGPGVRIN 225          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RL1_HELPH3.051e-3651.4150S ribosomal protein L1 OS=Helicobacter pylori (s... [more]
RL1_HELP23.051e-3651.4150S ribosomal protein L1 OS=Helicobacter pylori (s... [more]
RL1_HELHP3.051e-3650.0050S ribosomal protein L1 OS=Helicobacter hepaticus... [more]
RL1_HELPG3.985e-3651.4150S ribosomal protein L1 OS=Helicobacter pylori (s... [more]
RL1_BACSK3.985e-3652.6350S ribosomal protein L1 OS=Bacillus clausii (stra... [more]
RL1_LYSSC5.204e-3652.2450S ribosomal protein L1 OS=Lysinibacillus sphaeri... [more]
RL1_ACIBL5.204e-3652.5950S ribosomal protein L1 OS=Acidobacteria bacteriu... [more]
RL1_PETMO6.797e-3651.8050S ribosomal protein L1 OS=Petrotoga mobilis (str... [more]
RL1_DESHY6.797e-3650.7550S ribosomal protein L1 OS=Desulfitobacterium haf... [more]
RL1_DESHD6.797e-3650.7550S ribosomal protein L1 OS=Desulfitobacterium haf... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top