CK937435

Overview
NameCK937435
Unique NameCK937435
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length663
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK937435_ssr74 microsatellite CK937435_ssr74:74..85. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2029 contig Csv1_Contig2029:1..663. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: I4E3B_XENLA (Eukaryotic translation initiation factor 4E type 3-B OS=Xenopus laevis GN=eif4e3-B PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.805e-20
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 1
Query:   94 PQSQPHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDE----ADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLTDRITY 582
            P ++   L   WTFW D        A   S+++K+YT  T++ FW +Y  I   S LP+   +HL +   +P WE+   A GG W +   ++A+   +W E ++A IGEQF +     DE+ GV  SVR R+D + +W       A+ +G  K  ++I +L    ++
Sbjct:   36 PDTEGIPLNSPWTFWLDRSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPLVSNLPLRWSYHLMRGERKPLWEEESNAKGGVWKMKVPKEAS-SLVWKELLLATIGEQFTDHCSPEDEVIGVSVSVRDREDVVQVWN----GNASVVGEAKVLEKIYELLPNTSF 197          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: IF4E3_XENTR (Eukaryotic translation initiation factor 4E type 3 OS=Xenopus tropicalis GN=eif4e3 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.079e-20
Identity = 48/143 (33.57%), Postives = 77/143 (53.85%), Query Frame = 1
Query:   94 PQSQPHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDE----ADEICGVVASVRQRQDKLALWTKTAA 510
            P ++   L   WTFW D        A   S+++K+YT  T++ FW +Y  I + + LP+   +HL +   +P WE+   A GG W +   ++A+   +W E ++A IGEQF +     DE+ GV  SVR R+D + +W   A+
Sbjct:   36 PDTEGIPLHSPWTFWLDRSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPQVTNLPLRWSYHLMRGERKPLWEEESNAKGGVWKMKVPKEAS-SLVWKELLLATIGEQFTDRCAPEDEVIGVSVSVRDREDVVQVWNGNAS 177          
BLAST of CK937435 vs. ExPASy Swiss-Prot
Match: I4E3A_XENLA (Eukaryotic translation initiation factor 4E type 3-A OS=Xenopus laevis GN=eif4e3-A PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 8.959e-20
Identity = 53/162 (32.72%), Postives = 85/162 (52.47%), Query Frame = 1
Query:   94 PQSQPHKLERKWTFWFDNISKPKQGAAWGSSMRKVYTFDTVEEFWCLYEQIFKPSRLPMNADFHLFKTGIEPKWEDPECANGGKWSVTSNRKANLDTMWLETMMALIGEQFDE----ADEICGVVASVRQRQDKLALWTKTAANEAAQMGIGKKWKEILDLT 567
            P ++   L   WTFW D        A   S+++K+YT  T++ FW +Y  I   + LP+   +HL +   +P WE+   A GG W +   ++A+   +W E ++A IGEQF +     DE+ GV  SVR R+D + +W    A+  A+  + +K  E+L  T
Sbjct:   36 PDTEGIPLHSPWTFWLDRSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPLVTNLPVRWSYHLMRGERKPLWEEESNAKGGVWKMKVPKEAS-SLVWKELLLATIGEQFTDRCAPEDEVIGVSVSVRDREDIVQVWNGN-ASVVAEATVLEKIYELLPNT 195          
The following BLAST results are available for this feature:
BLAST of CK937435 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 43
Match NameE-valueIdentityDescription
I4E3B_XENLA1.805e-2031.74Eukaryotic translation initiation factor 4E type 3... [more]
IF4E3_XENTR3.079e-2033.57Eukaryotic translation initiation factor 4E type 3... [more]
I4E3A_XENLA8.959e-2032.72Eukaryotic translation initiation factor 4E type 3... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in pTriplEx2 vectorcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004780_F07 Developing fruit albedo at 80 DAFB in pTriplEx2 vector Citrus sinensis cDNA clone A80DAB0003_IVF_F07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK937435 ID=CK937435|Name=CK937435|organism=Citrus sinensis|type=EST|length=663bp
GGGGGGGAAAAAAATATAATTAATAGAAACAAAGAAGAGAGAGATATGGC
AACAAGTGAGGAGGCAAGCGCGACGGCGGCGGCGGAGGTGCCGCCGCAAT
CACAGCCGCACAAGCTCGAGAGAAAATGGACGTTTTGGTTCGACAACATA
TCAAAGCCCAAACAGGGCGCCGCGTGGGGCTCCTCCATGCGCAAAGTCTA
CACCTTCGACACTGTCGAAGAATTTTGGTGTTTGTATGAACAGATATTCA
AGCCAAGCCGGTTGCCAATGAATGCGGATTTCCATTTGTTCAAAACTGGG
ATAGAACCAAAGTGGGAAGATCCTGAGTGTGCGAATGGAGGAAAGTGGTC
GGTCACTAGCAACAGGAAGGCTAACCTTGATACCATGTGGCTTGAAACAA
TGATGGCCCTGATTGGAGAGCAATTTGATGAGGCGGATGAGATTTGTGGG
GTTGTTGCTAGTGTACGCCAGAGGCAGGACAAACTTGCCTTATGGACCAA
GACAGCAGCAAATGAAGCTGCTCAGATGGGCATTGGAAAGAAGTGGAAGG
AGATCCTCGATCTCACTGATAGGATCACTTACAGCTTCCACGATGACTCT
AGAAGGGATCGATCAGTGAAAAGTCGATACAGTGTGTGAACTCAAAAGTG
ACCGTTTTGTCGC
back to top