CV998078

Overview
NameCV998078
Unique NameCV998078
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10123 contig Csv1_Contig10123:852..1843. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAM_YEAST (Probable alanine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae GN=ALT1 PE=1 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 7.167e-68
Identity = 139/284 (48.94%), Postives = 180/284 (63.38%), Query Frame = -3
Query:  105 EVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGY---GEKD-ISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAI--VTRLTDFHKNFMDKFRN 938
            E++   + A    I    LVVINPGNPTG VL+ E+   I E   K G V++ADEVYQEN++ P  KFHS KK+ R +     G+ D + L S  S SKG  GECG+RGGYME+TGFS E+R+ I K+AS++LC  ++GQ L  L++ PP  G+ES+ES  AER+ I   L  RA TL + FNSLEGI C K +GAMYLFP+I LP          +  PD FYC++LL +TGI  VPGSGFGQ PGT+H R T L      P +  + +   FHK F D++R+
Sbjct:  315 EIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIF-PGTKFHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFL-----APGLEWIKKWESFHKEFFDQYRD 592          

HSP 2 Score: 25.0238 bits (53), Expect = 7.167e-68
Identity = 8/11 (72.73%), Postives = 10/11 (90.91%), Query Frame = -1
Query:  953 VPYYLDEATGW 985
            +PYYLDE +GW
Sbjct:  299 LPYYLDENSGW 309          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT1_HUMAN (Alanine aminotransferase 1 OS=Homo sapiens GN=GPT PE=1 SV=3)

HSP 1 Score: 255.373 bits (651), Expect = 7.176e-68
Identity = 132/259 (50.97%), Postives = 165/259 (63.71%), Query Frame = -3
Query:  123 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG---YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNF 890
            RAL VINPGNPTGQV   E   A++ F  +E L LLADEVYQ+NVY    +FHSFKKV   MG    G+++  L SF S SKGY GECG RGGY+EV    A V++Q+ K+ SV LC  + GQ L  LV+SPP   D S+  + AE+  +L+ LA +AK  E  FN   GI+CN  +GAMY FPR+QLP             PD F+C RLL  TGI +VPGSGFGQ  GT+HFR TILP  +K+  ++ +L+ FH  F
Sbjct:  235 RALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQE--LASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKF 491          

HSP 2 Score: 23.0978 bits (48), Expect = 7.176e-68
Identity = 9/18 (50.00%), Postives = 10/18 (55.56%), Query Frame = -1
Query:  932 VPYYLDEATGWGLKLRRL 985
            V YYLDE   W L +  L
Sbjct:  204 VDYYLDEERAWALDVAEL 221          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT2_XENTR (Alanine aminotransferase 2 OS=Xenopus tropicalis GN=gpt2 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.306e-67
Identity = 129/286 (45.10%), Postives = 177/286 (61.89%), Query Frame = -3
Query:  111 NRMGIETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMG--YGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 962
            N   ++ +E+++    A+ K    + L +INPGNPTGQV + +    ++ F  +E L L+ADEVYQ+NVY     FHSFKKV   MG  Y E  + L SF S SKGY GECG RGGYMEV      V++Q+ K+ SV LC  + GQ L  ++++PPK G+ SY+ + AE+  +L +LA +A+  E+  N   GI CN  +GAMY FPRI +P             PD F+C +LL  TGI +VPGSGFGQ  GT HFR TILP  DK+ +++ RL DFH+ F +++
Sbjct:  240 NCWALDINELRRSLTEAR-KHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSET-VELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFHQKFTEEY 523          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT_YEAST (Probable alanine aminotransferase OS=Saccharomyces cerevisiae GN=ALT2 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.212e-64
Identity = 129/284 (45.42%), Postives = 175/284 (61.62%), Query Frame = -3
Query:  105 TSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGY---GEKD-ISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKFRN 944
            + E++K  + A  K I    L+VINPGNPTG VL+EE    I     K G+ +++DEVYQEN++  + KFHS KKV R + +   G+ D + L S  S+SKG+  ECG+RGGYME+ GFS E+R+ ++K+ S+++CS ++GQ +  L++ PP+ GDESYE    ER  I   +  RA  L + F  LEGI C K +GAMYLFPR+ LP             PD FYC  LL +TGI  VPGSGFGQ PGT+H R T L    K    +    +FH++F  K+RN
Sbjct:  228 SDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIF-NDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTK---WIQDWKEFHQDFFSKYRN 507          

HSP 2 Score: 23.483 bits (49), Expect = 1.212e-64
Identity = 7/12 (58.33%), Postives = 10/12 (83.33%), Query Frame = -1
Query:  953 LVPYYLDEATGW 988
            ++PYYLDE + W
Sbjct:  213 VLPYYLDEESNW 224          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: ALAT_SCHPO (Putative alanine aminotransferase OS=Schizosaccharomyces pombe GN=SPBC582.08 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.655e-57
Identity = 115/289 (39.79%), Postives = 168/289 (58.13%), Query Frame = -3
Query:  111 NRMGIETSEVKKQWEAAKAKGITVRALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKD-----ISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDFHKNFMDKF 962
            N   I+  + KK ++ A  KGI VR  VVINPGNPTG  ++E +   ++ F K +G+VLLADEVYQ N+Y  + KFHSF++    +   E D     +SL+S  SVSKG +GECG+RGGY++V       ++QI K+A++++C  ++GQ+L  ++++PPK GD SY+ +  E D I  +L  + + L +    ++ ++C +  GAMYL P + LP          K  PD FY   LL  +GI +VPGSGFGQ  G +H R T L    K    + R    H   MD +
Sbjct:  221 NNWDIDFDQFKKSFDEASKKGINVRLCVVINPGNPTGACISENSMEKVLRFAKAKGIVLLADEVYQNNIY--QNKFHSFRRKLGELREKEPDNHWDQVSLISVNSVSKGQFGECGQRGGYLDVVNIPEPAKDQILKLATIDICPPVAGQLLVDMLVNPPKPGDPSYDLFIKEVDEIHEALRLQCRQLYEGTKRMKRVSCLEPHGAMYLHPSVSLPEKLITTAKAQKIQPDEFYAIELLKRSGICVVPGSGFGQPEGDYHIRITFLA---KGTEYIERFVKAHNEIMDLY 504          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: YFBQ_SHIFL (Uncharacterized aminotransferase yfbQ OS=Shigella flexneri GN=yfbQ PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.986e-16
Identity = 71/255 (27.84%), Postives = 114/255 (44.71%), Query Frame = -3
Query:  135 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVR---EQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF 890
            R +V+INP NPTG V ++E    IVE  ++  L++ ADE+Y + +Y  + + HS   ++        D+  ++F  +SK  Y   G R G+M + G     +   E +  +AS+ LC+N+  Q      +     G +S   +     G L     RA  L    N + G++C K  GA+Y+FP+I                 D       L    ++LV G+ F   P   HFR   LP+ D I   +++   F
Sbjct:  170 RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILY-DDAEHHSIAPLA-------PDLLTITFNGLSK-TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALG----GYQSISEFITP-GGRLYEQRNRAWEL---INDIPGVSCVKPRGALYMFPKIDAKRFNIH--------DDQKMVLDFLLQEKVLLVQGTAFNW-PWPDHFRIVTLPRVDDIELSLSKFARF 398          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: YFBQ_ECOLI (Uncharacterized aminotransferase yfbQ OS=Escherichia coli (strain K12) GN=yfbQ PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.986e-16
Identity = 71/255 (27.84%), Postives = 114/255 (44.71%), Query Frame = -3
Query:  135 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVR---EQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF 890
            R +V+INP NPTG V ++E    IVE  ++  L++ ADE+Y + +Y  + + HS   ++        D+  ++F  +SK  Y   G R G+M + G     +   E +  +AS+ LC+N+  Q      +     G +S   +     G L     RA  L    N + G++C K  GA+Y+FP+I                 D       L    ++LV G+ F   P   HFR   LP+ D I   +++   F
Sbjct:  170 RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILY-DDAEHHSIAPLA-------PDLLTITFNGLSK-TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALG----GYQSISEFITP-GGRLYEQRNRAWEL---INDIPGVSCVKPRGALYMFPKIDAKRFNIH--------DDQKMVLDFLLQEKVLLVQGTAFNW-PWPDHFRIVTLPRVDDIELSLSKFARF 398          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: YFBQ_ECOL6 (Uncharacterized aminotransferase yfbQ OS=Escherichia coli O6 GN=yfbQ PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.986e-16
Identity = 71/255 (27.84%), Postives = 114/255 (44.71%), Query Frame = -3
Query:  135 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVR---EQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF 890
            R +V+INP NPTG V ++E    IVE  ++  L++ ADE+Y + +Y  + + HS   ++        D+  ++F  +SK  Y   G R G+M + G     +   E +  +AS+ LC+N+  Q      +     G +S   +     G L     RA  L    N + G++C K  GA+Y+FP+I                 D       L    ++LV G+ F   P   HFR   LP+ D I   +++   F
Sbjct:  170 RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILY-DDAEHHSIAPLA-------PDLLTITFNGLSK-TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALG----GYQSISEFITP-GGRLYEQRNRAWEL---INDIPGVSCVKPRGALYMFPKIDAKRFNIH--------DDQKMVLDFLLQEKVLLVQGTAFNW-PWPDHFRIVTLPRVDDIELSLSKFARF 398          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: Y286_HAEIN (Uncharacterized aminotransferase HI0286 OS=Haemophilus influenzae GN=HI0286 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.986e-16
Identity = 73/263 (27.76%), Postives = 116/263 (44.11%), Query Frame = -3
Query:  123 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVR---EQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTW----HFRCTILPQEDKIPAIVTRLTDFHKNF 890
            +A+V+INP NPTG V ++E  + IVE  ++  L++ ADE+Y + +Y      H        +     D+  V+   +SK  Y   G R G+M + G     +   E +  +AS+ LC+N+  Q      +     G +S   +      +L    +R K   D    + GITC K  GAMY+FP+I +               D      LL    ++LV G GF      W    HFR   LP  +++   +T+L  F  ++
Sbjct:  170 KAIVIINPNNPTGAVYSKELLQEIVEIARQNNLIIFADEIYDKILYDGAVHHH--------IAALAPDLLTVTLNGLSKA-YRVAGFRQGWMILNGPKHNAKGYIEGLDMLASMRLCANVPMQHAIQTALG----GYQSINEFILPGGRLLE---QRNKAY-DLITQIPGITCVKPMGAMYMFPKIDVKKFNIH--------SDEKMVLDLLRQEKVLLVHGKGF-----NWHSPDHFRIVTLPYVNQLEEAITKLARFLSDY 402          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: AAT_MYCTU (Probable aspartate aminotransferase OS=Mycobacterium tuberculosis GN=aspC PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.160e-15
Identity = 72/255 (28.24%), Postives = 112/255 (43.92%), Query Frame = -3
Query:  135 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTG---FSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF 890
            +ALVVINP NPTG V + E    +V+  +K  L+LLADE+Y + +Y   K          S+     D+  ++F  +SK  Y   G R G++ +TG    ++   E I  +A++ LC N+  Q    + +     G +S E        +L     +        N + G++C K  GA+Y FPR+                 D      LL +  I++  G+GF   P   H R   LP    + A + RL +F
Sbjct:  195 KALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHI--------SLASIAPDMLCLTFNGLSKA-YRVAGYRAGWLAITGPKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALG----GHQSIEDLVLPGGRLL----EQRDIAWTKLNEIPGVSCVKPAGALYAFPRLD--------PEVYDIDDDEQLVLDLLLSEKILVTQGTGFNW-PAPDHLRLVTLPWSRDLAAAIERLGNF 423          
The following BLAST results are available for this feature:
BLAST of CV998078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
ALAM_YEAST7.167e-6848.94Probable alanine aminotransferase, mitochondrial O... [more]
ALAT1_HUMAN7.176e-6850.97Alanine aminotransferase 1 OS=Homo sapiens GN=GPT ... [more]
ALAT2_XENTR1.306e-6745.10Alanine aminotransferase 2 OS=Xenopus tropicalis G... [more]
ALAT_YEAST1.212e-6445.42Probable alanine aminotransferase OS=Saccharomyces... [more]
ALAT_SCHPO4.655e-5739.79Putative alanine aminotransferase OS=Schizosacchar... [more]
YFBQ_SHIFL3.986e-1627.84Uncharacterized aminotransferase yfbQ OS=Shigella ... [more]
YFBQ_ECOLI3.986e-1627.84Uncharacterized aminotransferase yfbQ OS=Escherich... [more]
YFBQ_ECOL63.986e-1627.84Uncharacterized aminotransferase yfbQ OS=Escherich... [more]
Y286_HAEIN3.986e-1627.76Uncharacterized aminotransferase HI0286 OS=Haemoph... [more]
AAT_MYCTU1.160e-1528.24Probable aspartate aminotransferase OS=Mycobacteri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-5_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC35_C05_043, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998078 ID=CV998078|Name=CV998078|organism=Citrus sinensis|type=EST|length=991bp
GTACGCTTTGTCCATTCACTCTGTAAACGTTTAACAATTGAAATGAATGG
CTACACATTATTTTTCTGAACTCAGTCTCATATTATTATGCAGAAGATCT
TTCAATTACGGAATTTGTCCATGAAATTTTTATGGAAGTCTGTCAGCCGG
GTCACAATCGCTGGAATCTTGTCCTCTTGAGGCAATATGGTGCACCTAAA
ATGCCAAGTGCCGGGGACCTGCCCAAAACCAGAACCAGGAACAAGAACAA
TTCCAGTGGCATTGAGAAGGCGGCGACAATAAAATGCATCTGGAACAGTT
TTTTCAGCTTCAGCAGCTTTAATTGCCTTTTCAGGCAGTTGAATACGAGG
AAAGAGATACATTGCTCCTTCAGCCTTGTTACATGTTATTCCTTCCAAAC
TGTTAAATGCATCTTCCAATGTCTTTGCACGCCTGGCTAAAGATGAGAGG
ATTCCATCCCTCTCAGCGCAATAGGACTCATAAGATTCATCTCCAACCTT
AGGTGGACTCATGACAAGGCTTGCCAGAATTTGGCCGGAGATATTAGAAC
AAAGATTCACAGATGCCACTTTGTATATTTGCTCCCTTACTTCAGCACTG
AACCCAGTGACCTCCATGTAACCTCCTCTTTTTCCACACTCCCCATAGTA
ACCTTTAGAAACTGACTGAAATGATACAAGGGATATATCCTTCTCACCAT
ACCCCATGGATCGGGATACCTTCTTAAAGGAATGGAATTTTTTCTCTGGC
ACATAAACATTTTCCTGGTATACCTCATCTGCAAGAAGAACAAGACCCTC
CTTTTTGCAGAACTCCACAATTGCACGCTGGTTTTCTTCAGCAAGAACCT
GTCCAGTTGGATTGCCTGGATTTATTACAACCAAGGCCCTAACGGTAATA
CCTTTGGCCTTGGCGGCCTCCCATTGCTTCTTAACCTCCGAAGTTTCAAT
CCCCATCCTGTTGCTTCATCTAGGTAGTAAGGCACCAAGGT
back to top