EY665459

Overview
NameEY665459
Unique NameEY665459
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length834
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_MEDSA (Cell division protease ftsH homolog, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 8.169e-63
Identity = 106/146 (72.60%), Postives = 122/146 (83.56%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK P+++TA+GA+IPKG LLVGPPGTGKTLLA+A+AGEAG PFFS + SEFVE+FVGVGASRVRDLF+KAK  APCIVF+DEIDAV           NDEREQT+NQLLTEMDGF GN+G+IV+AATNR D+LDSALLR   F
Sbjct:  269 VDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGTPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRF 414          

HSP 2 Score: 46.2098 bits (108), Expect = 8.169e-63
Identity = 27/65 (41.54%), Postives = 34/65 (52.31%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFA 629
            PGRFDRQVTVD PD+ G+ + ++    S  K  A  V       +TPGF   D   L  +A I A
Sbjct:  411 PGRFDRQVTVDRPDVAGRVKILQ--VHSRGKALAKDVDFDKIARRTPGFTGVDLQNLMNEAAILA 473          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_CAPAN (Cell division protease ftsH homolog, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 2.362e-62
Identity = 105/146 (71.92%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK P+++TA+GA+IPKG LLVGPPGTGKTLLA+A+AGEAGVPFFS + SEFVE+FVGVGASRVR LF+ AK  APCIVF+DEIDAV           NDEREQT+NQLLTEMDGF GN+G+IV+AATNR D+LDSALLR   F
Sbjct:  246 VDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGVPFFSCAASEFVELFVGVGASRVRHLFENAKSKAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGKF 391          

HSP 2 Score: 47.7506 bits (112), Expect = 2.362e-62
Identity = 28/65 (43.08%), Postives = 35/65 (53.85%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFA 629
            PG+FDRQVTVD PD+ G+ R ++    S  K  A  V       +TPGF  AD   L  +A I A
Sbjct:  388 PGKFDRQVTVDRPDVAGRVRILQ--VHSRGKALAKDVDFDKIARRTPGFTGADLQNLMNEAAILA 450          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_SHIFL (Cell division protease ftsH OS=Shigella flexneri GN=ftsH PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 5.238e-62
Identity = 104/146 (71.23%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +L++P RF  +G +IPKGVL+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F++AK+ APCI+F+DEIDAV           +DEREQTLNQ+L EMDGFEGN GIIVIAATNR D+LD ALLR   F
Sbjct:  168 VEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 50.0618 bits (118), Expect = 5.238e-62
Identity = 32/83 (38.55%), Postives = 44/83 (53.01%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIK---RFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVA--IVFEK 668
            PGRFDRQV V +PD+RG+ + +K   R        DA  ++       TPGF  AD A L  +A +FA    ++V   + FEK
Sbjct:  310 PGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIA-----RGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEK 387          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_SALTY (Cell division protease ftsH OS=Salmonella typhimurium GN=ftsH PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 5.238e-62
Identity = 104/146 (71.23%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +L++P RF  +G +IPKGVL+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F++AK+ APCI+F+DEIDAV           +DEREQTLNQ+L EMDGFEGN GIIVIAATNR D+LD ALLR   F
Sbjct:  168 VEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 50.0618 bits (118), Expect = 5.238e-62
Identity = 30/80 (37.50%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVA--IVFEK 668
            PGRFDRQV V +PD+RG+ + +K      +   A  +        TPGF  AD A L  +A +FA    ++V   + FEK
Sbjct:  310 PGRFDRQVVVGLPDVRGREQILK--VHMRRVPLATDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEK 387          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_SALTI (Cell division protease ftsH OS=Salmonella typhi GN=ftsH PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 5.238e-62
Identity = 104/146 (71.23%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +L++P RF  +G +IPKGVL+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F++AK+ APCI+F+DEIDAV           +DEREQTLNQ+L EMDGFEGN GIIVIAATNR D+LD ALLR   F
Sbjct:  168 VEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 50.0618 bits (118), Expect = 5.238e-62
Identity = 30/80 (37.50%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVA--IVFEK 668
            PGRFDRQV V +PD+RG+ + +K      +   A  +        TPGF  AD A L  +A +FA    ++V   + FEK
Sbjct:  310 PGRFDRQVVVGLPDVRGREQILK--VHMRRVPLATDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEK 387          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_ECOLI (Cell division protease ftsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 5.238e-62
Identity = 104/146 (71.23%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +L++P RF  +G +IPKGVL+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F++AK+ APCI+F+DEIDAV           +DEREQTLNQ+L EMDGFEGN GIIVIAATNR D+LD ALLR   F
Sbjct:  168 VEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 50.0618 bits (118), Expect = 5.238e-62
Identity = 32/83 (38.55%), Postives = 44/83 (53.01%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIK---RFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVA--IVFEK 668
            PGRFDRQV V +PD+RG+ + +K   R        DA  ++       TPGF  AD A L  +A +FA    ++V   + FEK
Sbjct:  310 PGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIA-----RGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEK 387          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_ECO57 (Cell division protease ftsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 5.238e-62
Identity = 104/146 (71.23%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +L++P RF  +G +IPKGVL+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F++AK+ APCI+F+DEIDAV           +DEREQTLNQ+L EMDGFEGN GIIVIAATNR D+LD ALLR   F
Sbjct:  168 VEYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 50.0618 bits (118), Expect = 5.238e-62
Identity = 32/83 (38.55%), Postives = 44/83 (53.01%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIK---RFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVA--IVFEK 668
            PGRFDRQV V +PD+RG+ + +K   R        DA  ++       TPGF  AD A L  +A +FA    ++V   + FEK
Sbjct:  310 PGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIA-----RGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEK 387          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_STRR6 (Cell division protease ftsH homolog OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.514e-61
Identity = 110/146 (75.34%), Postives = 120/146 (82.19%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK P+RFT +GARIP GVLL GPPGTGKTLLAKA+AGEAGVPFFSISGS+FVEMFVGVGASRVR LF+ AK+ AP I+F+DEIDAV           NDEREQTLNQLL EMDGFEGN GIIVIAATNR+D+LD ALLR   F
Sbjct:  203 VEFLKDPKRFTKLGARIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPAIIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDPALLRPGRF 348          

HSP 2 Score: 44.2838 bits (103), Expect = 1.514e-61
Identity = 25/72 (34.72%), Postives = 37/72 (51.39%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQV 650
            PGRFDR+V V  PD++G+   +K    +  K  A  V L    +QTPGF  AD   +  +A + A    + +
Sbjct:  345 PGRFDRKVLVGRPDVKGREAILK--VHAKNKPLAEDVDLKLVAQQTPGFVGADLENVLNEAALVAARRNKSI 414          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_STRPN (Cell division protease ftsH homolog OS=Streptococcus pneumoniae GN=ftsH PE=3 SV=3)

HSP 1 Score: 214.157 bits (544), Expect = 1.514e-61
Identity = 110/146 (75.34%), Postives = 120/146 (82.19%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FLK P+RFT +GARIP GVLL GPPGTGKTLLAKA+AGEAGVPFFSISGS+FVEMFVGVGASRVR LF+ AK+ AP I+F+DEIDAV           NDEREQTLNQLL EMDGFEGN GIIVIAATNR+D+LD ALLR   F
Sbjct:  203 VEFLKDPKRFTKLGARIPAGVLLEGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGASRVRSLFEDAKKAAPAIIFIDEIDAVGRQRGVGLGGGNDEREQTLNQLLIEMDGFEGNEGIIVIAATNRSDVLDPALLRPGRF 348          

HSP 2 Score: 44.2838 bits (103), Expect = 1.514e-61
Identity = 25/72 (34.72%), Postives = 37/72 (51.39%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQV 650
            PGRFDR+V V  PD++G+   +K    +  K  A  V L    +QTPGF  AD   +  +A + A    + +
Sbjct:  345 PGRFDRKVLVGRPDVKGREAILK--VHAKNKPLAEDVDLKLVAQQTPGFVGADLENVLNEAALVAARRNKSI 414          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_BUCBP (Cell division protease ftsH OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=ftsH PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.515e-61
Identity = 100/146 (68.49%), Postives = 120/146 (82.19%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +LK+P RF  +G +IPKG+L+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F+ +++ APCI+F+DEIDAV           +DEREQTLNQ+L EMDGF+GN GII+IAATNR D+LD ALLR   F
Sbjct:  168 VEYLKEPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEHSRKVAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFDGNEGIILIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 53.5286 bits (127), Expect = 1.515e-61
Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVAIV 659
            PGRFDRQ+ V +PDIRG+ + I+      K    N V  M     TPGF  AD A L  +A +FA  + R V ++
Sbjct:  310 PGRFDRQIFVALPDIRGREKIIQ--VHMKKVPLGNNVDPMIIARGTPGFSGADLANLVNEAALFAARNNRDVVMM 382          
The following BLAST results are available for this feature:
BLAST of EY665459 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 380
Match NameE-valueIdentityDescription
FTSH_MEDSA8.169e-6372.60Cell division protease ftsH homolog, chloroplastic... [more]
FTSH_CAPAN2.362e-6271.92Cell division protease ftsH homolog, chloroplastic... [more]
FTSH_SHIFL5.238e-6271.23Cell division protease ftsH OS=Shigella flexneri G... [more]
FTSH_SALTY5.238e-6271.23Cell division protease ftsH OS=Salmonella typhimur... [more]
FTSH_SALTI5.238e-6271.23Cell division protease ftsH OS=Salmonella typhi GN... [more]
FTSH_ECOLI5.238e-6271.23Cell division protease ftsH OS=Escherichia coli (s... [more]
FTSH_ECO575.238e-6271.23Cell division protease ftsH OS=Escherichia coli O1... [more]
FTSH_STRR61.514e-6175.34Cell division protease ftsH homolog OS=Streptococc... [more]
FTSH_STRPN1.514e-6175.34Cell division protease ftsH homolog OS=Streptococc... [more]
FTSH_BUCBP1.515e-6168.49Cell division protease ftsH OS=Buchnera aphidicola... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-D01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665459 ID=EY665459|Name=EY665459|organism=Citrus sinensis|type=EST|length=834bp
CCCACGCGTCCGGTTCCTTAAGAAGCCTGAGAGATTTACAGCTGTTGGAG
CTCGTATTCCAAAGGGTGTTCTTCTCGTTGGTCCTCCAGGAACTGGGAAG
ACTCTTCTTGCCAAGGCAATTGCTGGTGAAGCCGGTGTTCCATTTTTCTC
CATATCAGGTTCTGAGTTTGTTGAGATGTTTGTTGGTGTCGGTGCATCTA
GAGTCCGAGATCTTTTCAAGAAGGCCAAAGAGAATGCTCCTTGCATTGTA
TTTGTGGATGAAATTGATGCCGTTGGAAGACAAAGAGGAACTGGAATTGG
AGGAGGGAATGATGAAAGAGAGCAGACCCTTAACCAGCTTTTGACAGAAA
TGGATGGTTTTGAGGGTAATACTGGTATCATTGTGATTGCTGCAACTAAC
AGGGCGGACATTCTTGATTCTGCCTTATTGAGGGCCTGGACGTTTTGATA
GACAGGTTACTGTTGATGTTCCTGACATTCGAGGAAAGAACAGAGATATT
AAAAGGTTCACGGGTAGCAACAAAAAATTTGATGCAAATGGTGTCTCCTT
GATGGGAAAGCCAGAACAAACCCCTGGGTTCCAGGCTGCTGACTTTGCAA
CCCTCAAAGAACAGGCAGGCATCTTTGCGTGCGACGACGGGCGGCAAGTG
GCTATTGTATTTGAAAAAAAATGACCAATACAAGTGAAACGCAATGTTCA
TTCACACCCAACACAATCACCCTCACCAAACACGGGCAGAAACGACTGAT
AGTCGGAACGCACAAACACGCGCCCGAGAAAAAGCAAGCACCCGAAACCT
CGGAAACAATAATGCCATCATTACAACTCAGACC
back to top