EY665457

Overview
NameEY665457
Unique NameEY665457
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_BOMMO (Calreticulin OS=Bombyx mori GN=crt PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.154e-15
Identity = 62/185 (33.51%), Postives = 80/185 (43.24%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDF-----EPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLKFGC*KRKLEGEE 676
            KI DP+A KPEDWD D P  I D +  KPE W            ATKP                           GEW+ PM  NP YKG W    IDNP YKG W   +I NP Y     PD      + I AVG+++W       +F+ FLI+ D  + +    ++         K++ EGE+
Sbjct:  207 KIKDPEAKKPEDWD-DKP-TIPDPEDKKPEDW--DKPEHIPDPDATKPEDWDDEMD-------------------GEWEPPMIDNPDYKGVWAPKQIDNPAYKGPWVHPEIDNPEY----TPDSNLYKRDEICAVGLDLWQVKSGT-IFDDFLITDDPAAAKERGEVI---------KKRQEGEK 354          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_CAEBR (Calreticulin OS=Caenorhabditis briggsae GN=crt-1 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.791e-15
Identity = 59/183 (32.24%), Postives = 80/183 (43.72%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-FEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLKFGC*KRKLEGEEAA 682
            KI DPDA KPEDWDE     I+D + VKPE W              KP             P    P+       GEW+ PM  NP YKG+W    I NP YKG W   +I NP Y   D+   +E   A+G ++W       +F+  LI+   +  +  +      LK    ++K + +E A
Sbjct:  202 KIKDPDAKKPEDWDERE--YIDDAEDVKPEDW-------------EKPEHIPD--------PDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYLYENWGAIGFDLWQVKSGT-IFDNVLITDSVEEAEAHAAETFDKLKTVEKEKKEKADEEA 360          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_CAEEL (Calreticulin OS=Caenorhabditis elegans GN=crt-1 PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.499e-14
Identity = 52/144 (36.11%), Postives = 65/144 (45.14%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDK-PDFEPIAAVGIEIWD-NAGWVF 562
            KI DPDA KPEDWDE     I+D +  KPE W              KP             P    P+       GEW+ PM  NP YKG+W    I NP YKG W   +I NP Y   D+   +E   A+G ++W   +G +F
Sbjct:  202 KIKDPDAKKPEDWDERE--YIDDAEDAKPEDW-------------EKPEHIPD--------PDAKKPEDWDDEMDGEWEPPMIDNPEYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIF 322          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_NICPL (Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.558e-14
Identity = 65/207 (31.40%), Postives = 81/207 (39.13%), Query Frame = 2
Query:  140 IPDPDAVKPEDWDE----------------DAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD---FEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLK------FGC*KRKLEGEEAAA 685
            I DP A KPEDWDE                D P EI D DA KPE W                                D+ +       GEW  P   NP YKG W    I NPNYKG WK   I NP++   D PD   F  +  VG+E+W       LF+  +I  D +  + ++    G  K      F   ++K E EE+ A
Sbjct:  216 IKDPSAKKPEDWDEKEFIDDPEDKKPEGYDDIPEEITDPDAKKPEDW--------------------------------DDEE------DGEWTAPTIPNPEYKGPWKPKKIKNPNYKGKWKAPLIDNPDF--KDDPDLYVFPKLKYVGVELWQVKSGT-LFDNIVICDDPEYAKAIAEETWGKQKDAEKAAFEEAEKKREEEESKA 381          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_BETVU (Calreticulin OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.340e-14
Identity = 58/187 (31.02%), Postives = 74/187 (39.57%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWD----------------EDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD---FEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLK 640
            KI DP+A KPEDWD                +D P EI D +A KPE W                                D+ +       GEW  P   NP YKG W A  I NPNYKG WK   I NP +   D P+   +  +  VG+E+W       LF+  L+  D +  + L+    G  K
Sbjct:  213 KIKDPEAKKPEDWDDKEFIPDPEDKKPEGYDDIPAEITDPEAKKPEDW--------------------------------DDEE------DGEWTAPTIPNPEYKGPWKAKKIKNPNYKGKWKAPMIDNPEF--KDDPELYVYPKLRYVGVELWQVKSGT-LFDNVLVCDDPEYAKQLAEETWGKQK 358          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_BERST (Calreticulin OS=Berberis stolonifera PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.658e-13
Identity = 62/189 (32.80%), Postives = 79/189 (41.80%), Query Frame = 2
Query:  140 IPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD---FEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVLSGLLHGSLK------FGC*KRKLEGEEA 679
            IPDP+  KPE +D D P EI D +A KPE W                                D+ +       GEW  P   NP YKG+W    I NPN+KG WK   I NP++   D PD   F  +  VGIE+W       +F+  LI  D    + L+    G  K      F   ++K E EEA
Sbjct:  228 IPDPEDKKPEGYD-DIPKEITDPEAKKPEDW--------------------------------DDEED------GEWTAPTIPNPDYKGEWKPKKIKNPNFKGKWKAPMIDNPDF--KDDPDIYVFPKLKYVGIELWQVKSGT-MFDNVLICDDPDYAKKLAEETWGKNKDAEKAAFDEAEKKKEEEEA 374          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_SCHMA (Calreticulin OS=Schistosoma mansoni PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.165e-13
Identity = 46/134 (34.33%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  167 EDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNY-FELDKPDFEPIAAVGIEIWD-NAGWVF 562
            +DWD   P +I+D +  KP+ W+             KP              K  +   +A    GEW+RP K NP YKG+W    IDNP YKG WKP QI NP Y  + +      I  VG ++W  ++G +F
Sbjct:  196 DDWDMLPPKKIDDPNDKKPDDWVDEQFIDDPDD--KKPDNWDQPKTIPDMDAKKPDDWDDAMD--GEWERPQKDNPEYKGEWTPRRIDNPKYKGEWKPVQIDNPEYKHDPELYVLNDIGYVGFDLWQVDSGSIF 325          
The following BLAST results are available for this feature:
BLAST of EY665457 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
CALR_BOMMO5.154e-1533.51Calreticulin OS=Bombyx mori GN=crt PE=1 SV=1[more]
CALR_CAEBR8.791e-1532.24Calreticulin OS=Caenorhabditis briggsae GN=crt-1 P... [more]
CALR_CAEEL1.499e-1436.11Calreticulin OS=Caenorhabditis elegans GN=crt-1 PE... [more]
CALR_NICPL2.558e-1431.40Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 ... [more]
CALR_BETVU3.340e-1431.02Calreticulin OS=Beta vulgaris PE=2 SV=1[more]
CALR_BERST1.658e-1332.80Calreticulin OS=Berberis stolonifera PE=2 SV=1[more]
CALR_SCHMA2.165e-1334.33Calreticulin OS=Schistosoma mansoni PE=2 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-C09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665457 ID=EY665457|Name=EY665457|organism=Citrus sinensis|type=EST|length=916bp
GTGACTGCGGTACGGTCGGGATTCCCGGGTCGACCCCGCGTCCGCGCTGC
TGATGATTTTCAGCCTCTTTCTCATTCCTGAGAAGACAATTCCTGATCCA
GATGACAAGAAGCCTGAGGATTGGGATGAGAGGGCAAAGATTCCTGACCC
TGATGCAGTAAAACCTGAAGACTGGGATGAGGATGCTCCCATGGAAATTG
AAGATGAGGATGCTGTGAAACCTGAAGGATGGCTGGATGATGACCCTGAG
GAGATAGATGACCCTGAGGCCACAAAACCTGAGGATTGGGATGATGAGGA
GGATGGTGAATGGGAGGCCCCAAAGATTGATAACCCAAAGTGTGAAGCAG
CCCCTGGATGCGGCGAGTGGAAGAGGCCAATGAAGAGGAATCCTGCCTAC
AAGGGCAAATGGCATGCTCCACATATTGACAACCCTAATTACAAGGGTAT
TTGGAAGCCTCAGCAGATTCCAAACCCCAACTATTTTGAGCTTGACAAAC
CTGACTTTGAGCCTATTGCTGCTGTTGGCATTGAGATCTGGGACAATGCA
GGATGGGTATTTTTGTTTGAAACATTTTTGATATCAAAGGATGAGAAAAG
TTGCCAAGTCCTATCGGGCCTCCTGCATGGAAGCCTAAAGTTTGGATGTT
GAAAAAGAAAACTTGAAGGTGAGGAAGCAGCTGCTTGGTTCAAAGGGCTT
TGCAGGCTTCCCGAAAAAAGGAATTGATTCTCTTGAACAAGGGTTGCAAA
AATTCCTTTCTTGGATGCATACCAACTTAAAAAATCTTGAATGGGATTGA
AAAAGGGAAAAAAAAAACCCAACCCTTAAAATTTGGGTTTTCCTTGCTTT
CTGTTTGGGGGGGGGAATTTTTCCCATTTCTTTTTCCAAAATACTTATTT
GTGGGGGGAAAAGAAA
back to top