EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_HORVU (Peroxidase 1 OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 8.547e-14
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAI-GIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPECI 469
            AS+LL      + +  +  +  +R F  I++IK  +E  C   VSCADIL ++ RD VVALGGP   +  GRRD   +        LP  N S + +   F    G++   +VAL G+H++G+  C     R+Y   D  +N  +   +   CP+ +
Sbjct:   72 ASVLLSG----MEQNAIPNAGSLRGFGVIDSIKTQIEAICKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSIDANENEANTDLPGFNSSRAELEAAFLKKGGLNTVDMVALSGAHTIGQAQCSTFRARIYGG-DTNINAAYAASLRANCPQTV 223          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_MAIZE (Peroxidase 1 OS=Zea mays GN=PER1 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.116e-13
Identity = 52/165 (31.52%), Postives = 77/165 (46.67%), Query Frame = 2
Query:   68 MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRA-EILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE--------VDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQH 535
            +R F  I+  K AVE+ CP  VSCADI+  + RD +   G     +  GRRDGR S A E ++  LP    +   + + F A  +    +V L G+H+VGR+ C     R++          VD  L+P +   +   CP        +     D GTP VL+ +
Sbjct:  108 LRGFDVIDAAKTAVEQSCPRTVSCADIVAFAARDSISLTGSVSYQVPAGRRDGRVSNATETVD--LPPPTSTAQSLTDLFKAKELSVEDMVVLSGAHTVGRSFCASFFKRVWNTSTNPATAIVDAGLSPSYAQLLRALCPSNTTQTTPIT-TAMDPGTPNVLDNN 269          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERA_IPOBA (Anionic peroxidase OS=Ipomoea batatas PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.845e-11
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGV-VSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHC 376
            A LLL+ T     E+     +  +R F  IE  K+ V+ + P + VSCADIL ++ RD      G    +  GR+D R +        L   N++++  L +FAA G +   +VALLGSH++G   C
Sbjct:  108 AGLLLNDTATFTGEQTAAGNNNSVRGFAVIEQAKQNVKTQMPDMSVSCADILSIAARDSFEKFSGSTYTVTLGRKDARTANFTGANTQLVGPNENLTSQLTKFAAKGFNGTEMVALLGSHTIGFARC 234          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_SORBI (Cationic peroxidase SPC4 (Fragment) OS=Sorghum bicolor PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.845e-11
Identity = 44/125 (35.20%), Postives = 70/125 (56.00%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVERECPG-VVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRK--SRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSV 361
            AS+LLD +     E++   +  +R   F+ I +I + + +EC G VVSC+D+L L+ RD VV  GGP   +  GRRD     ++ ++L   LP    ++  +L   + I +DA  LVAL G H++
Sbjct:   90 ASVLLDGSATGPGEQQAPPNLTLRPTAFKAINDIHDRLHKECGGTVVSCSDVLALAARDSVVVSGGPSYKVPLGRRDSASFATQQDVLSG-LPPPTAAVPALLAVLSKINLDATDLVALSGGHTI 213          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER1_HORVU8.547e-1431.85Peroxidase 1 OS=Hordeum vulgare PE=2 SV=1[more]
PER1_MAIZE1.116e-1331.52Peroxidase 1 OS=Zea mays GN=PER1 PE=1 SV=1[more]
PERA_IPOBA8.845e-1133.86Anionic peroxidase OS=Ipomoea batatas PE=1 SV=1[more]
PER1_SORBI8.845e-1135.20Cationic peroxidase SPC4 (Fragment) OS=Sorghum bic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top