EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER61_ARATH (Probable peroxidase 61 OS=Arabidopsis thaliana GN=PER61 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.527e-21
Identity = 59/146 (40.41%), Postives = 83/146 (56.85%), Query Frame = 2
Query:   38 SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            SE+   ++ G+  F  I+ IK+ +E  CPGVVSCADIL L+ RD V   G P  P+ TGRRDG    A+ ++  LP  + S+   L  F + G+D   +  LLG+HS+G+THC  +V RLY      + DP +N   V  +   CP
Sbjct:   95 SERTAPQNRGLGGFVIIDKIKQVLESRCPGVVSCADILNLATRDAVHMAGAPSYPVFTGRRDGGTLNADAVD--LPSPSISVDESLAYFKSKGLDVLDMTTLLGAHSMGKTHCSYVVDRLYNFKNTGKPDPTMNTTLVSQLRYLCP 238          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER25_ARATH (Peroxidase 25 OS=Arabidopsis thaliana GN=PER25 PE=2 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 7.219e-21
Identity = 67/207 (32.37%), Postives = 104/207 (50.24%), Query Frame = 2
Query:   59 SFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLKKWAKIQELTSLR 664
            + G+R    I++ K  +E  CPGVVSCADIL L+ RD V    GP   + TGR+DGR S A      LP   DS++V  ++F   G+D   LV LLG+H++G+T C+   +RLY        DP ++P  +  +   CP   P+    + V  D G+P   ++            ++E D  L  + E   ++ K  ++++ L   R
Sbjct:   94 NLGLRGLEVIDDAKARLEAVCPGVVSCADILALAARDSVDLSDGPSWRVPTGRKDGRISLATEASN-LPSPLDSVAVQKQKFQDKGLDTHDLVTLLGAHTIGQTDCLFFRYRLYNFTVTGNSDPTISPSFLTQLKTLCP---PNGDGSKRVALDIGSPSKFDESFF-KNLRDGNAILESDQRLWSDAETNAVVKKYASRLRGLLGFR 295          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_ARATH (Peroxidase 1/2 OS=Arabidopsis thaliana GN=PER1 PE=1 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 7.219e-21
Identity = 67/209 (32.06%), Postives = 105/209 (50.24%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRN-DRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEK 613
            S+LL S +   +E++   +  ++ +  ++  K A+ER+CP ++SCAD+L L  RD V  +GGP+ P+  GRRDGR S+       LP     +  + + FA  G++A  LV L G H++G + C  +  RLY      + DP++NP +V  +   CP     P   +   N D G+ L  + H         KGL   D  L  + E K
Sbjct:   76 SVLLKSAKND-AERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVIGGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCP-----PTDFRTSLNMDPGSALTFDTHYF-KVVAQKKGLFTSDSTLLDDIETK 277          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER28_ARATH (Peroxidase 28 OS=Arabidopsis thaliana GN=PER28 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 9.428e-21
Identity = 61/149 (40.94%), Postives = 80/149 (53.69%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY---------PEVDPAL 421
            ASLL+D T   LSEK    +F +R F  I+ IK A+E +CP  VSC+DI+ L+ RD V   GGP   + TGRRDG  S  E   + LP    S+  +L  F   G++    VALLG+H+VG   C   V R+          P +DP L
Sbjct:   72 ASLLIDPTTSQLSEKNAGPNFSVRGFELIDEIKTALEAQCPSTVSCSDIVTLATRDAVFLGGGPSYVVPTGRRDGFVSNPEDANEILPPPFISVEGMLSFFGNKGMNVFDSVALLGAHTVGIASCGNFVDRVTNFQGTGLPDPSMDPTL 220          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER27_ARATH (Peroxidase 27 OS=Arabidopsis thaliana GN=PER27 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 9.428e-21
Identity = 60/156 (38.46%), Postives = 89/156 (57.05%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*C 457
            S+LLD       EK    +  +R F  I++ K A+E+ CPG+VSC+DIL L  RD +VAL GP   ++TGRRDGR S   I E  LP   D+++ ++  F + G++   LV L G H++G  HC  L +RLY      + DP+L+ ++   +   C
Sbjct:   76 SVLLDKPNNQ-GEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPSWEVETGRRDGRVS--NINEVNLPSPFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKC 228          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER4_VITVI (Peroxidase 4 OS=Vitis vinifera GN=GSVIVT00023967001 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.231e-20
Identity = 53/138 (38.41%), Postives = 77/138 (55.80%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 412
            AS+LLD T     E+  +     +R    I+NIK  VE  CPGVVSCADI+ ++ RD VV LGGP   +K GRRD + +        +P    S+S ++ +F A G+    +VAL G+H++G+  C     R+Y E +
Sbjct:   76 ASVLLDDTSSFTGEQTAVPNKNSIRGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDVKLGRRDSKTASLSGANNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTSFRARIYNETN 213          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER39_ARATH (Peroxidase 39 OS=Arabidopsis thaliana GN=PER39 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.608e-20
Identity = 53/153 (34.64%), Postives = 89/153 (58.17%), Query Frame = 2
Query:    5 SLLLDSTRKTLS-EKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHM 445
            S+L+++T      EK    +  +R F +I+ +K A+E +CPG+VSCADI+ L+ RD +VA+GGP   + TGRRDGR S        +P    + + ++  F   G+D   LV L G+H++G +HC    +RL+      + DP+L+ ++  ++
Sbjct:   75 SILINATSSNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSIVAIGGPTWNVPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNL 227          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER2_ARMRU (Peroxidase C2 OS=Armoracia rusticana GN=PRXC2 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.608e-20
Identity = 68/221 (30.77%), Postives = 112/221 (50.68%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T    +EK+    +   R F  I+ +K AVE+ CP  VSCAD+L ++ +  VV  GGP   + +GRRD  +   ++    LP  + ++ V+ ++F  +G+D P  LVAL G H+ G+  C  ++ RLY      + DP L+  ++  +   CP    +      V  D  TP + +           KGLI+ D  L  +P+  +   L++ +A
Sbjct:   75 ASILLDNTTSFRTEKDAFGNARSARGFDVIDTMKAAVEKACPKTVSCADLLAIAAQKSVVLAGGPSWKVPSGRRDSLRGFMDLANDNLPGPSSTLQVLKDKFRNVGLDRPSDLVALSGGHTFGKNQCQFIMDRLYNFSNSGKPDPTLDKSYLSTLRKQCPR---NGNLSVLVDFDLRTPTIFDNKYY-VNLKENKGLIQSDQELFSSPDASDTIPLVRAYA 291          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER15_ARATH (Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.608e-20
Identity = 70/225 (31.11%), Postives = 104/225 (46.22%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYW----TTKGLIEVDLHLTPEQEEKTLLLKKWAKIQE 649
            SLLLD++   ++EK  +  S   R F  ++ IK A+E ECP  VSCAD L L+ RD  V  GGP   +  GRRD   +        +P  N++ + ++ RF   G+D   +VAL GSH++G + C     RLY +      D  L   +  ++   CP    D    +   N  G            +Y+       GL+  D  L    E+   L+KK+A+ QE
Sbjct:   86 SLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTFNTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDRTLEQSYAANLRQRCPRSGGDQNLSELDINSAGR--------FDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQE 302          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER67_ARATH (Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.743e-20
Identity = 57/134 (42.54%), Postives = 78/134 (58.21%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSR-AEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            SLLLD T   L EK    S   +R F  I+ IK  VE+ CPG+VSCADIL ++ RD V+ LGGP   +K GRRD   +  A      +P    ++S ++ RF A G+    +VAL G+H++GR  CV   +R+Y
Sbjct:   71 SLLLDDTPSFLGEKTSGPSNNSVRGFEVIDKIKFKVEKMCPGIVSCADILAITARDSVLLLGGPGWSVKLGRRDSTTANFAAANSGVIPPPITTLSNLINRFKAQGLSTRDMVALSGAHTIGRAQCVTFRNRIY 204          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER61_ARATH5.527e-2140.41Probable peroxidase 61 OS=Arabidopsis thaliana GN=... [more]
PER25_ARATH7.219e-2132.37Peroxidase 25 OS=Arabidopsis thaliana GN=PER25 PE=... [more]
PER1_ARATH7.219e-2132.06Peroxidase 1/2 OS=Arabidopsis thaliana GN=PER1 PE=... [more]
PER28_ARATH9.428e-2140.94Peroxidase 28 OS=Arabidopsis thaliana GN=PER28 PE=... [more]
PER27_ARATH9.428e-2138.46Peroxidase 27 OS=Arabidopsis thaliana GN=PER27 PE=... [more]
PER4_VITVI1.231e-2038.41Peroxidase 4 OS=Vitis vinifera GN=GSVIVT0002396700... [more]
PER39_ARATH1.608e-2034.64Peroxidase 39 OS=Arabidopsis thaliana GN=PER39 PE=... [more]
PER2_ARMRU1.608e-2030.77Peroxidase C2 OS=Armoracia rusticana GN=PRXC2 PE=3... [more]
PER15_ARATH1.608e-2031.11Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=... [more]
PER67_ARATH2.743e-2042.54Peroxidase 67 OS=Arabidopsis thaliana GN=PER67 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top