EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER46_ARATH (Peroxidase 46 OS=Arabidopsis thaliana GN=PER46 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.757e-19
Identity = 58/202 (28.71%), Postives = 99/202 (49.01%), Query Frame = 2
Query:   38 SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL-------YPEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLL 622
            +EK    +  +  F  I+  K A+E  CP  VSCADI+ L+ RD V A GGP + + TGRRDG++S A  +   + D + ++  +++ F++ G+    LV L G+H++G +HC     R        +  +D +L+  +   ++    +C     +   V ND  T  V +         T KGL + D  L  +   +T++
Sbjct:   87 TEKSDPGNASLGGFSVIDTAKNAIENLCPATVSCADIVALAARDAVEAAGGPVVEIPTGRRDGKESMAANVRPNIIDTDFTLDQMIDAFSSKGLSIQDLVVLSGAHTIGASHCNAFNGRFQRDSKGNFEVIDASLDNSYAETLM---NKCSSSESSSLTVSNDPETSAVFDNQYY-RNLETHKGLFQTDSALMEDNRTRTMV 284          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1C_ARMRU (Peroxidase C1C (Fragment) OS=Armoracia rusticana GN=PRXC1C PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.757e-19
Identity = 71/225 (31.56%), Postives = 110/225 (48.89%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T    +EK+    +   R F  ++ IK AVER CP  VSCAD+L ++ +  V   GGP   +  GRRD R++  ++    LP  + ++  +   FA +G++ P  LVAL G H+ G+  C  ++ RLY        DP LN  ++  +   CP        V +   D  TP V +       Y+      KGLI+ D  L  +P   +   L++ +A
Sbjct:   60 ASILLDNTTSFRTEKDAFGNANSARGFPVVDRIKAAVERACPRTVSCADVLTIAAQQSVNLAGGPSWRVPLGRRDSRQAFLDLANANLPAPSFTLPELKAAFANVGLNRPSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRQQCPRNGNQSVLVDF---DLRTPTVFD-----NKYYVNLKEQKGLIQSDQELFSSPNATDTIPLVRSYA 276          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER8_ARATH (Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 8.825e-19
Identity = 54/142 (38.03%), Postives = 83/142 (58.45%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALL-GSHSVGRTHCVKLVHRLY-PEVDPAL 421
            ASLL+D T +  SEK + R+ G+R F  I+  K+ +E  CP  VSCADI+ ++ RD +   GGP   ++TGRRDG +S    ++   P    S++  ++ F +IG +   +VAL+ G H+VG  HC     R+  P++D  L
Sbjct:   71 ASLLIDPTTERPSEKSVGRNAGVRGFEIIDEAKKELELVCPKTVSCADIVTIATRDSIALAGGPKFKVRTGRRDGLRSNPSDVKLLGP--TVSVATSIKAFKSIGFNVSTMVALIGGGHTVGVAHCSLFQDRIKDPKMDSKL 210          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER38_ARATH (Peroxidase 38 OS=Arabidopsis thaliana GN=PER38 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 8.825e-19
Identity = 65/221 (29.41%), Postives = 111/221 (50.23%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGID-APGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T    +EK+    +   R F  I+ +K A+E+ CP  VSCAD+L ++ ++ +V  GGP   +  GRRD  +   ++    LP  + ++  + +RF  +G+D +  LVAL G H+ G++ C  ++ RLY        DP L+  ++  +   CP        V +   D  TP + +           KGLI+ D  L  +P+  +   L++ +A
Sbjct:   73 ASILLDNTTSFRTEKDAFGNANSARGFDVIDKMKAAIEKACPRTVSCADMLAIAAKESIVLAGGPSWMVPNGRRDSLRGFMDLANDNLPGPSSTLKQLKDRFKNVGLDRSSDLVALSGGHTFGKSQCQFIMDRLYNFGETGLPDPTLDKSYLATLRKQCPRNGNQSVLVDF---DLRTPTLFDNKYY-VNLKENKGLIQSDQELFSSPDAADTLPLVRAYA 289          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER37_ARATH (Peroxidase 37 OS=Arabidopsis thaliana GN=PER37 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 8.825e-19
Identity = 68/221 (30.77%), Postives = 111/221 (50.23%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGID-APGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T    +EK+    +   R F  I+ +K AVE+ CP  VSCAD+L ++ ++ VV  GGP   +  GRRD  +   ++    LP    +++ + +RF  +G+D A  LVAL G H+ G+  C  ++ RLY        DP L+  ++  +   CP        V +   D  TP + +           KGLI+ D  L  +P+  +   L++++A
Sbjct:   73 ASILLDNTTSFRTEKDAFGNANSARGFDVIDKMKAAVEKACPKTVSCADLLAIAAQESVVLAGGPSWRVPNGRRDSLRGFMDLANDNLPAPFFTLNQLKDRFKNVGLDRASDLVALSGGHTFGKNQCQFIMDRLYNFSNTGLPDPTLDKSYLSTLRKQCPRNGNQSVLVDF---DLRTPTLFDNKYY-VNLKENKGLIQSDQELFSSPDASDTLPLVREYA 289          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER20_ARATH (Peroxidase 20 OS=Arabidopsis thaliana GN=PER20 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 8.825e-19
Identity = 69/221 (31.22%), Postives = 103/221 (46.61%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL-YPEVDPALNPD----HVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQH----LL*GTYWTTKGLIEVDLHLTPEQEEKTLLLKKW 634
            AS+LLD+    LSEK+   +   +R F  I+ IK  +E  CP  VSC+DIL L+ RD V   GGP+  +  GRRD  K+      Q++P  N S+  ++  F   G++   L+AL G+H++G+  CV    R+  P ++     D    H         +C    +  +    D  TP   + H    LL G     +GL+  D  L  E  E  +  K W
Sbjct:   79 ASVLLDTHGDMLSEKQATPNLNSLRGFEVIDYIKYLLEEACPLTVSCSDILALAARDSVFLRGGPWWEVLLGRRDSLKASFAGANQFIPAPNSSLDSLIINFKQQGLNIQDLIALSGAHTIGKARCVSFKQRIVQPNMEQTFYVDEFRRHSTFRRVLGSQCKDSSRDNELSPLDIKTPAYFDNHYFINLLEG-----RGLLISDNVLVSEDHEGEIFQKVW 294          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER5_VITVI (Peroxidase 5 OS=Vitis vinifera GN=GSVIVT00037159001 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.153e-18
Identity = 55/159 (34.59%), Postives = 83/159 (52.20%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSF-GMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPE 463
            S+L+DST    +EK+   +   +R F  I++ K  +E  C GVVSCADI+  + RD V   GG    +  GRRDGR S A      LP    ++  + + F+  G+    +V L G+H++GR+HC    +RLY        DP L+P +   +   CP+
Sbjct:  111 SVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAVCKGVVSCADIVAFAARDSVEITGGLGYDVPAGRRDGRISLASEASTNLPPPTFTVDQLTQFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYAASLKTQCPQ 269          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER24_ARATH (Peroxidase 24 OS=Arabidopsis thaliana GN=PER24 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.153e-18
Identity = 61/161 (37.89%), Postives = 83/161 (51.55%), Query Frame = 2
Query:    2 ASLLLDSTR-KTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGV-VALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPE 463
            ASLLLDS   K +SEKE   +  +  F  I+ IK  +E+ CP  VSCADIL L+ RD V      P   + TGR DGR S A    + LP    + + + + FA   +D   LVAL G+H++G  HC     RL       + DP+LNP +   +   C +
Sbjct:   95 ASLLLDSVAGKAVSEKEARPNLSLSGFEIIDEIKYILEKRCPNTVSCADILTLAARDAVSYEFERPLWNVFTGRVDGRVSLATEAARDLPSAGANFTTLQKLFAESDLDVVDLVALSGAHTIGIAHCGVFGRRLLNFTGKGDTDPSLNPSYASFLKSECSD 255          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER19_ARATH (Peroxidase 19 OS=Arabidopsis thaliana GN=PER19 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.153e-18
Identity = 67/217 (30.88%), Postives = 108/217 (49.77%), Query Frame = 2
Query:    5 SLLLDSTR--KTLSEKEMDRSFGMRN--FRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLK 628
            S+L+++ +  K L+E+E   +  +R   F  I   K  VE  CP +VSC+DIL ++ RD +   GGPY  +K GR DG++S A+ +   +P  N ++  +++ FA+ G+    LV L GSH++G  HC   + RLY        DP+L+   +  +   CP       +   +  D  TP V +     G   T  GL+  D  L  +   K + L+
Sbjct:   92 SILIETKKGSKKLAEREAYENKELREEGFDSIIKAKALVESHCPSLVSCSDILAIAARDFIHLAGGPYYQVKKGRWDGKRSTAKNVPPNIPRSNSTVDQLIKLFASKGLTVEELVVLSGSHTIGFAHCKNFLGRLYDYKGTKRPDPSLDQRLLKELRMSCP--FSGGSSGVVLPLDATTPFVFDNGYFTG-LGTNMGLLGSDQALFLDPRTKPIALE 305          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER7_ARATH (Peroxidase 7 OS=Arabidopsis thaliana GN=PER7 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.505e-18
Identity = 53/133 (39.85%), Postives = 77/133 (57.89%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            AS+LLD      +E+    S  +R F  I++IK  +E+ CPG VSCADIL  + R   V LGGPY P   GRRD + S A  +E+ +P     ++ +LE F + G++   LV L G+H++G+  C  +  RLY
Sbjct:  100 ASVLLDYEG---TERRSPASKTLRGFELIDDIKSEMEKSCPGKVSCADILTSASRAATVQLGGPYWPNVYGRRDSKHSYARDVEK-VPSGRRDVTALLETFQSYGLNVLDLVVLSGAHTIGKASCGTIQSRLY 228          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER46_ARATH6.757e-1928.71Peroxidase 46 OS=Arabidopsis thaliana GN=PER46 PE=... [more]
PER1C_ARMRU6.757e-1931.56Peroxidase C1C (Fragment) OS=Armoracia rusticana G... [more]
PER8_ARATH8.825e-1938.03Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 ... [more]
PER38_ARATH8.825e-1929.41Peroxidase 38 OS=Arabidopsis thaliana GN=PER38 PE=... [more]
PER37_ARATH8.825e-1930.77Peroxidase 37 OS=Arabidopsis thaliana GN=PER37 PE=... [more]
PER20_ARATH8.825e-1931.22Peroxidase 20 OS=Arabidopsis thaliana GN=PER20 PE=... [more]
PER5_VITVI1.153e-1834.59Peroxidase 5 OS=Vitis vinifera GN=GSVIVT0003715900... [more]
PER24_ARATH1.153e-1837.89Peroxidase 24 OS=Arabidopsis thaliana GN=PER24 PE=... [more]
PER19_ARATH1.153e-1830.88Peroxidase 19 OS=Arabidopsis thaliana GN=PER19 PE=... [more]
PER7_ARATH1.505e-1839.85Peroxidase 7 OS=Arabidopsis thaliana GN=PER7 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top