EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER58_ARATH (Peroxidase 58 OS=Arabidopsis thaliana GN=PER58 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.505e-18
Identity = 57/162 (35.19%), Postives = 88/162 (54.32%), Query Frame = 2
Query:    5 SLLLDSTRK--TLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY------PEVDPALNPDHVPHMLP*CPE 463
            S+LLD+        EKE  ++ G +  F  I++IK A+E  CPGVVSCADIL ++    V   GGP + +  GRRDGR +        LP   DS+ ++  +F+   +D   LVAL G+H+ GR  C  + +RL+       + DP++ P+ +  +   CP+
Sbjct:   75 SVLLDAAPADGVEGEKEAFQNAGSLDGFEVIDDIKTALENVCPGVVSCADILAIAAEISVALAGGPSLDVLLGRRDGRTAIRADAVAALPLGPDSLEILTSKFSVHNLDTTDLVALSGAHTFGRVQCGVINNRLHNFSGNSGQSDPSIEPEFLQTLRRQCPQ 236          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER50_ARATH (Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.505e-18
Identity = 60/181 (33.15%), Postives = 94/181 (51.93%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVER--ECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTP 517
            AS+++ ST    +EK+ + +  +    F  +   KEA++    C   VSCADIL ++ RD V   GGP   ++ GR DG  S A  +   LP   D ++ +   FA  G+    ++AL G+H++G  HC K+ +R+Y      +VDP +N D+V  +   CP  I DP+    +  D  TP
Sbjct:   76 ASVMIASTNNNKAEKDHEENLSLAGDGFDTVIKAKEALDAVPNCRNKVSCADILTMATRDVVNLAGGPQYDVELGRLDGLSSTAASVGGKLPHPTDDVNKLTSLFAKNGLSLNDMIALSGAHTLGFAHCTKVFNRIYTFNKTTKVDPTVNKDYVTELKASCPRNI-DPRVA--INMDPTTP 253          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER4_ARATH (Peroxidase 4 OS=Arabidopsis thaliana GN=PER4 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.966e-18
Identity = 52/134 (38.81%), Postives = 78/134 (58.21%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSF-GMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            AS++L +T    SE++   +F   R F  I+  K AVE  CPGVVSCADI+ ++ RD    +GGP   +K GRRD   +   I ++ LP+   S++ + E F   G++   LVAL G+H++G+  C+    RLY
Sbjct:   70 ASVMLVATPTMESERDSLANFQSARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYDVKVGRRDSTNAFRAIADRDLPNFRASLNDLSELFLRKGLNTRDLVALSGAHTLGQAQCLTFKGRLY 203          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER33_ARATH (Peroxidase 33 OS=Arabidopsis thaliana GN=PER33 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.966e-18
Identity = 71/225 (31.56%), Postives = 110/225 (48.89%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T    +EK+ +  +   R F  I+ +K AVER CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  ++    LP    ++  +   F  +G+D P  LVAL G+H+ G+  C  ++ RLY        DP LN  ++  +   CP        V +   D  TPLV +       Y+      KGLI+ D  L  +P   +   L++ +A
Sbjct:   82 ASILLDNTTSFRTEKDALGNANSARGFPVIDRMKAAVERACPRTVSCADMLTIAAQQSVTLAGGPSWKVPLGRRDSLQAFLDLANANLPAPFFTLPQLKANFKNVGLDRPSDLVALSGAHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGQCPRNGNQSVLVDF---DLRTPLVFD-----NKYYVNLKEQKGLIQSDQELFSSPNATDTIPLVRAYA 298          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER68_ARATH (Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.568e-18
Identity = 54/135 (40.00%), Postives = 76/135 (56.30%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDG-RKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            AS+LLD TR  L EK     +  +R +  I+ IK  VER CPGVVSCADIL ++ RD V+ +GG    +K GRRD    S +      LP    ++  ++  F A G+    +VAL G+H++G+  CV    R+Y
Sbjct:   79 ASILLDDTRSFLGEKTAGPNNNSVRGYEVIDAIKSRVERLCPGVVSCADILAITARDSVLLMGGRGWSVKLGRRDSITASFSTANSGVLPPPTSTLDNLINLFRANGLSPRDMVALSGAHTIGQARCVTFRSRIY 213          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERN1_TOBAC (Peroxidase N1 OS=Nicotiana tabacum GN=poxN1 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.353e-18
Identity = 54/137 (39.42%), Postives = 76/137 (55.47%), Query Frame = 2
Query:   68 MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPE 463
            ++ F  IE+ K  +E  CPGVVSCADIL L+ RD VVA  G    + TGRRDGR SRA      LP   DS+ +   +F   G++   LVAL G+H++G   C  +  RL+        DP+++   +P +   CP+
Sbjct:  100 LKGFDVIEDAKTQIEAICPGVVSCADILALAARDSVVATRGLTWSVPTGRRDGRVSRAADAGD-LPAFFDSVDIQKRKFLTKGLNTQDLVALTGAHTIGTAGCAVIRDRLFNFNSTGGPDPSIDATFLPQLRALCPQ 235          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER57_ARATH (Peroxidase 57 OS=Arabidopsis thaliana GN=PER57 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.353e-18
Identity = 61/149 (40.94%), Postives = 80/149 (53.69%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY---------PEVDPAL 421
            ASLL+DST    SEK    +  +R F  I+ IK  +E  CP  VSCADI+ L+ RD V   GGP   + TGRRDGR S    L+  LP    S+S  +  F   G++    VALLG+H+VG+ +C     R+          P +DPAL
Sbjct:   73 ASLLIDSTN---SEKTAGPNGSVREFDLIDRIKAQLEAACPSTVSCADIVTLATRDSVALAGGPSYSIPTGRRDGRVSNN--LDVTLPGPTISVSGAVSLFTNKGMNTFDAVALLGAHTVGQGNCGLFSDRITSFQGTGRPDPSMDPAL 216          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERN_ARMRU (Peroxidase N OS=Armoracia rusticana GN=HRPN PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 4.380e-18
Identity = 54/134 (40.30%), Postives = 76/134 (56.72%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEK-EMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            AS+LLD T    SEK  +     +R F  I+ IK AVE  CPGVVSCADIL L+ RD V   GGP   +  GR+DG  +        LP   + +  ++ +FAA+G++   +VAL G+H+ G+  C    +RL+
Sbjct:   79 ASVLLDGTN---SEKLAIPNVNSVRGFEVIDTIKAAVENACPGVVSCADILTLAARDSVYLSGGPQWRVALGRKDGLVANQSSANN-LPSPFEPLDAIIAKFAAVGLNVTDVVALSGAHTFGQAKCDLFSNRLF 208          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER6_ARATH (Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.720e-18
Identity = 59/178 (33.15%), Postives = 94/178 (52.81%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMD--RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDP----ALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTP 517
            AS+L+ ST +  SE++ D  RS     F  I  IK AVE +CP +VSC+DILV + R  +  +GGP + +K GR+D   S    +E  L   N +M  ++  F + G+    +VAL+G+H++G +HC +   R++ + D      +NP +   +   C     D +   +  ND  TP
Sbjct:   71 ASILVASTPRKTSERDADINRSLPGDAFDVITRIKTAVELKCPNIVSCSDILVGATRSLISMVGGPRVNVKFGRKDSLVSDMNRVEGKLARPNMTMDHIISIFESSGLTVQEMVALVGAHTIGFSHCKEFASRIFNKSDQNGPVEMNPKYAAELRKLCANYTNDEQMSAF--NDVFTP 246          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER65_ARATH (Peroxidase 65 OS=Arabidopsis thaliana GN=PER65 PE=2 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 5.720e-18
Identity = 60/175 (34.29%), Postives = 89/175 (50.86%), Query Frame = 2
Query:    2 ASLLL--DSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTP 517
            AS+L+  +S  K   + +++ S     F  +  IK A+E  CPGVVSCADIL  + RD V  +GGPY  +K GR+DG +S+A  +   +P  N ++  +   F   G     +VAL G+H++G +HC +   RLY    D  +NP     +   C     D     +  ND  TP
Sbjct:   82 ASVLIATNSFNKAERDDDLNDSLPGDAFDIVTRIKTALELSCPGVVSCADILAQATRDLVTMVGGPYFDVKLGRKDGFESKAHKVRGNVPMANQTVPDIHGIFKKNGFSLREMVALSGAHTIGFSHCKEFSDRLYGSRADKEINPRFAAALKDLCKNHTVDDTIAAF--NDVMTP 254          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER58_ARATH1.505e-1835.19Peroxidase 58 OS=Arabidopsis thaliana GN=PER58 PE=... [more]
PER50_ARATH1.505e-1833.15Peroxidase 50 OS=Arabidopsis thaliana GN=PER50 PE=... [more]
PER4_ARATH1.966e-1838.81Peroxidase 4 OS=Arabidopsis thaliana GN=PER4 PE=2 ... [more]
PER33_ARATH1.966e-1831.56Peroxidase 33 OS=Arabidopsis thaliana GN=PER33 PE=... [more]
PER68_ARATH2.568e-1840.00Peroxidase 68 OS=Arabidopsis thaliana GN=PER68 PE=... [more]
PERN1_TOBAC3.353e-1839.42Peroxidase N1 OS=Nicotiana tabacum GN=poxN1 PE=1 S... [more]
PER57_ARATH3.353e-1840.94Peroxidase 57 OS=Arabidopsis thaliana GN=PER57 PE=... [more]
PERN_ARMRU4.380e-1840.30Peroxidase N OS=Armoracia rusticana GN=HRPN PE=2 S... [more]
PER6_ARATH5.720e-1833.15Peroxidase 6 OS=Arabidopsis thaliana GN=PER6 PE=2 ... [more]
PER65_ARATH5.720e-1834.29Peroxidase 65 OS=Arabidopsis thaliana GN=PER65 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top