EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER10_ARATH (Peroxidase 10 OS=Arabidopsis thaliana GN=PER10 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.470e-18
Identity = 46/133 (34.59%), Postives = 73/133 (54.89%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            S+LL+ +     EK    +   +R F  IE+IK  +E  CP  VSCADI+ L+ R+ VV  GGP+ P+  GRRD   +  +     LP   +++  +  +F  +G+D   +V L G+H++G   C  + HRL+
Sbjct:   98 SILLNDSEDFKGEKNAQPNRNSVRGFEVIEDIKSDIESSCPLTVSCADIVALAAREAVVLTGGPFWPVPLGRRDSLTASEQAANTNLPSPFEALENITAKFVTLGLDLKDVVVLSGAHTIGFAQCFVIKHRLF 230          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_ARAHY (Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 9.757e-18
Identity = 56/154 (36.36%), Postives = 79/154 (51.30%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CP 460
            AS+LLD T     EK     +  +R F  I+ IK  VE  CPGVVSCADIL ++ RD VVALGG    +  GRRD   +        LP    ++S ++  F+  G     LV L G+H++G+  C     R+Y E +  ++P +   +   CP
Sbjct:   73 ASVLLDDTSNFTGEKTAGPNANSIRGFEVIDTIKSQVESLCPGVVSCADILAVAARDSVVALGGASWNVLLGRRDSTTASLSSANSDLPAPFFNLSGLISAFSNKGFTTKELVTLSGAHTIGQAQCTAFRTRIYNESN--IDPTYAKSLQANCP 224          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER16_ARATH (Peroxidase 16 OS=Arabidopsis thaliana GN=PER16 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 9.757e-18
Identity = 59/162 (36.42%), Postives = 85/162 (52.47%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEM--DRSFGMRNFRYIENIKEAVERE--CPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            AS+LL S     SEK+   D+S     F  +   K+A++R+  C   VSCADIL L+ RD VV  GGP  P++ GRRDGR S    ++  LP  +  +  +   FA  G+    ++AL G+H++G  HC K   R+Y       +DP LN  +   +   CP
Sbjct:   74 ASILLASP----SEKDHPDDKSLAGDGFDTVAKAKQALDRDPNCRNKVSCADILALATRDVVVLTGGPNYPVELGRRDGRLSTVASVQHSLPQPSFKLDQLNTMFARHGLSQTDMIALSGAHTIGFAHCGKFSKRIYNFSPKRPIDPTLNIRYALQLRQMCP 231          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER13_ARATH (Peroxidase 13 OS=Arabidopsis thaliana GN=PER13 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 9.757e-18
Identity = 50/134 (37.31%), Postives = 76/134 (56.72%), Query Frame = 2
Query:   65 GMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVAL-LGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPE 463
            G+  F  I+  K  +ER CPGVVSCADI+ L+ RD +    GP+  + TGRRDG  +  +  +  LPD  DS++ +  +F   G+    LV L  G+H++G T C  ++ RL  + DP +NP+    +   CP+
Sbjct:   93 GVAGFDVIDEAKSELERFCPGVVSCADIVALAARDAIAEAKGPFYEVPTGRRDGLIANVDHAKN-LPDVQDSINTLKSKFREKGLSDQDLVLLSAGAHTIGTTACFFVIPRLDAQ-DPTINPEFFQILRSKCPQ 224          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER60_ARATH (Peroxidase 60 OS=Arabidopsis thaliana GN=PER60 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.274e-17
Identity = 58/161 (36.02%), Postives = 89/161 (55.28%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGG--PYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPE 463
            ASLLLD +    SEK+   +  +R +  I++IK AVE+EC  VVSCADI+ L+ RD V    G      + TGR DG+ S A +++  LP    +++    +F    +    +V LLG H++G THC  ++ RLY      + DP+++P  V  +   CP+
Sbjct:   77 ASLLLDGSN---SEKKASPNLSVRGYEVIDDIKSAVEKECDRVVSCADIIALATRDLVTLASGGKTRYEIPTGRLDGKISSALLVD--LPSPKMTVAETAAKFDQRKLSLNDMVLLLGGHTIGVTHCSFIMDRLYNFQNTQKPDPSMDPKLVEELSAKCPK 232          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER31_ARATH (Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.274e-17
Identity = 47/134 (35.07%), Postives = 79/134 (58.96%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL 397
            AS+L+ ST    +E++   +  +    F  I   K A+E  CP  VSC+DI+ ++ RD ++ +GGPY  +  GRRD R S++ +L   LP  +  +S ++++F + G     +VAL G+HS+G +HC + V R+
Sbjct:   70 ASVLISSTAFNTAERDSSINLSLPGDGFDVIVRAKTALELACPNTVSCSDIISVATRDLLITVGGPYYDVFLGRRDSRTSKSSLLTDLLPLPSTPISKIIQQFESKGFTVQEMVALSGAHSIGFSHCKEFVGRV 203          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER29_ARATH (Peroxidase 29 OS=Arabidopsis thaliana GN=PER29 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.664e-17
Identity = 54/175 (30.86%), Postives = 94/175 (53.71%), Query Frame = 2
Query:    2 ASLLLDSTR-KTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAE-ILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL--YPEVDPALNPDHVPHMLP*CPECIPDPKAVQ--YVRNDR 508
            AS+LL+  R +  +E +  ++FG+R    + +IK ++E ECP  VSC+D+++L+ RD V   GGP I +  GR+D   + ++ + +  LP     +   L  FA  G+     VA++G+H++G THC  ++ R          ++P     +   CPE  P  +A +  +V ND+
Sbjct:   87 ASILLEPIRDQQFTELDSAKNFGIRKRDLVGSIKTSLELECPKQVSCSDVIILAARDAVALTGGPLISVPLGRKDSLSTPSKHVADSELPPSTADVDTTLSLFANKGMTIEESVAIMGAHTIGVTHCNNVLSRFDNANATSENMDPRFQTFLRVACPEFSPTSQAAEATFVPNDQ 261          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER62_ARATH (Peroxidase 62 OS=Arabidopsis thaliana GN=PER62 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.174e-17
Identity = 51/147 (34.69%), Postives = 79/147 (53.74%), Query Frame = 2
Query:   38 SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALL-GSHSVGRTHCVKLVHRLYPE----VDPALNPDHVPHMLP*CPE 463
            SE+    +  +  F  I++ K  +E  CPGVVSCADIL L+ RD V    G    + TGRRDGR S A  +   LP  +DS+++   +F+A  ++   LV L+ G H++G   C  + +R++       DP ++   VP +   CP+
Sbjct:   83 SERTAGANVNLHGFEVIDDAKRQLEAACPGVVSCADILALAARDSVSLTNGQSWQVPTGRRDGRVSLASNVNN-LPSPSDSLAIQQRKFSAFRLNTRDLVTLVGGGHTIGTAACGFITNRIFNSSGNTADPTMDQTFVPQLQRLCPQ 228          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER34_ARATH (Peroxidase 34 OS=Arabidopsis thaliana GN=PER34 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 2.839e-17
Identity = 71/225 (31.56%), Postives = 107/225 (47.56%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T    +EK+    +   R F  I+ +K AVER CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  E+    LP    ++  +   F  +G+D P  LVAL G H+ G+  C  ++ RLY        DP LN  ++  +   CP    +      V  D  TP V +       Y+      KGLI+ D  L  +P   +   L++ +A
Sbjct:   81 ASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVERACPRTVSCADMLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLELANANLPAPFFTLPQLKASFRNVGLDRPSDLVALSGGHTFGKNQCQFILDRLYNFSNTGLPDPTLNTTYLQTLRGLCP---LNGNRSALVDFDLRTPTVFD-----NKYYVNLKERKGLIQSDQELFSSPNATDTIPLVRAYA 297          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERX_TOBAC (Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.708e-17
Identity = 53/142 (37.32%), Postives = 79/142 (55.63%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPD 430
            S+LLD T  T +EK+   + G   F  +++IK A+E  CPGVVSCADIL L+   GVV   GP   +  GR+D   +        +P   ++++V++ +F   G+D   LVAL G+H+ GR  C     RL+   + + NPD
Sbjct:   74 SILLD-TDGTQTEKDAPANVGAGGFDIVDDIKTALENVCPGVVSCADILALASEIGVVLAKGPSWQVLFGRKDSLTANRSGANSDIPSPFETLAVMIPQFTNKGMDLTDLVALSGAHTFGRARCGTFEQRLF-NFNGSGNPD 213          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER10_ARATH7.470e-1834.59Peroxidase 10 OS=Arabidopsis thaliana GN=PER10 PE=... [more]
PER1_ARAHY9.757e-1836.36Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 ... [more]
PER16_ARATH9.757e-1836.42Peroxidase 16 OS=Arabidopsis thaliana GN=PER16 PE=... [more]
PER13_ARATH9.757e-1837.31Peroxidase 13 OS=Arabidopsis thaliana GN=PER13 PE=... [more]
PER60_ARATH1.274e-1736.02Peroxidase 60 OS=Arabidopsis thaliana GN=PER60 PE=... [more]
PER31_ARATH1.274e-1735.07Peroxidase 31 OS=Arabidopsis thaliana GN=PER31 PE=... [more]
PER29_ARATH1.664e-1730.86Peroxidase 29 OS=Arabidopsis thaliana GN=PER29 PE=... [more]
PER62_ARATH2.174e-1734.69Peroxidase 62 OS=Arabidopsis thaliana GN=PER62 PE=... [more]
PER34_ARATH2.839e-1731.56Peroxidase 34 OS=Arabidopsis thaliana GN=PER34 PE=... [more]
PERX_TOBAC3.708e-1737.32Lignin-forming anionic peroxidase OS=Nicotiana tab... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top