EY665182

Overview
NameEY665182
Unique NameEY665182
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1045
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_NEOFI (ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.750e-23
Identity = 67/163 (41.10%), Postives = 94/163 (57.67%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS Q  P Y+ V +  +  T   LQQ Y + P  ++  +L+SF++ NL  K MVF SS   V+F  E  R++Q  +    +HG+QKQ  R      F +++  +L  TDVAARGLD PAVDW++Q D P E  + Y      TA +++  +G A LFLD
Sbjct:  240 DLARLSLQD-PEYVAVHETASSATPSKLQQHYVITPLPQKLDILWSFIRSNLKSKTMVFLSSGKQVRFVYESFRHLQPGIPLMHLHGRQKQGGRLDIVTRFSQSKHCVLFSTDVAARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTARYER--EGRAVLFLD 398          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_ASPTN (ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 4.750e-23
Identity = 67/163 (41.10%), Postives = 92/163 (56.44%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS Q  P Y+ V +     T   LQQ Y V P  ++  +L+SF++ NL  K +VF SS   V+F  E  R++Q  +    +HG+QKQ  R      + +A+  +L  TDVAARGLD PAVDW++Q D P E  + Y      TA +++   G A LFLD
Sbjct:  239 DLARLSLQD-PEYVAVHEAAASATPSTLQQHYVVTPLPQKLDILWSFIRSNLKSKTIVFLSSGKQVRFVYEAFRHLQPGIPLMHLHGRQKQGGRLDITTKYSQAKHAVLFSTDVAARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTARYER--DGRAVLFLD 397          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_ASPFU (ATP-dependent RNA helicase dbp4 OS=Aspergillus fumigatus GN=dbp4 PE=3 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.750e-23
Identity = 67/163 (41.10%), Postives = 94/163 (57.67%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS Q  P Y+ V +  +  T   LQQ Y + P  ++  +L+SF++ NL  K MVF SS   V+F  E  R++Q  +    +HG+QKQ  R      F +++  +L  TDVAARGLD PAVDW++Q D P E  + Y      TA +++  +G A LFLD
Sbjct:  240 DLARLSLQD-PEYVAVHETASSATPSKLQQHYVITPLPQKLDILWSFIRSNLKSKTMVFLSSGKQVRFVYESFRHLQPGIPLMHLHGRQKQGGRLDIVTRFSQSKHCVLFSTDVAARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTARYER--EGRAVLFLD 398          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_USTMA (ATP-dependent RNA helicase DBP4 OS=Ustilago maydis GN=DBP4 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.204e-23
Identity = 69/164 (42.07%), Postives = 94/164 (57.32%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTK-VTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            +DLARLS Q  P Y+ V +   +  T  GL+Q Y +V   K+  LL+SF++ +   K +VF SSC  V+F  E    ++  V    +HGKQKQ KR   F  F K +  +L  TD+AARGLD PAVDW++Q D P E  + Y      TA +   AKGN+ LF+
Sbjct:  250 KDLARLSLQD-PEYVAVREPENEGCTPRGLEQHYMLVELEKKLDLLFSFIRTHTKCKALVFMSSCRQVQFVHETFCKLRPGVSLMALHGKQKQAKRLQIFTQFTKTQHALLFATDIAARGLDFPAVDWVIQLDVP-EDVDTYIHRVGRTARYT--AKGNSLLFV 409          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_EMENI (ATP-dependent RNA helicase dbp4 OS=Emericella nidulans GN=dbp4 PE=3 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 6.204e-23
Identity = 68/163 (41.72%), Postives = 92/163 (56.44%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS Q  P Y+ V +  +  T   LQQ Y V P  ++   L+SF++ NL  K +VF SS   V+F  E  R++Q  +    +HG+QKQ  R      F +A+  +L  TDVAARGLD PAVDW++Q D P E  + Y      TA +++   G A LFLD
Sbjct:  241 DLARLSLQD-PEYVAVHEAASSATPSKLQQHYVVTPLPQKLDTLWSFIRSNLKSKTIVFMSSGKQVRFVYESFRHMQPGIPLLHLHGRQKQGGRLDITTRFSQAQHAVLFSTDVAARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTARYER--DGRAVLFLD 399          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_CHAGB (ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum GN=DBP4 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 8.103e-23
Identity = 68/170 (40.00%), Postives = 92/170 (54.12%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHF 507
            DLARLS +  P Y+   +     T   LQQ Y V P A++   L+ FL+ NL  K++VFFSS   V+F  E  + +Q  +    +HG+QKQ  R      F  A+ G L  TDV ARG+D PAVDW+VQ D P E  + Y      TA ++  +KG A LFL+  +   F
Sbjct:  246 DLARLSLKE-PEYVSAHEAAVSATPTNLQQSYIVTPLAEKLDTLFGFLRTNLKSKIIVFFSSGKQVRFVFESFKRMQPGIPLLHLHGRQKQVARMEITSRFSSAKYGCLFATDVVARGVDFPAVDWVVQADCP-EDADTYIHRVGRTARYE--SKGRAVLFLEPSEEAGF 411          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_ASPOR (ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae GN=dbp4 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.382e-22
Identity = 66/163 (40.49%), Postives = 93/163 (57.06%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS Q  P Y+ V +  +  T   LQQ Y V P +++  +L+SF++ NL  K +VF SS   V+F  E  R++Q  +    +HG+QKQ  R      F +A+  +L  TD+ ARGLD PAVDW++Q D P E  + Y      TA +++   G A LFLD
Sbjct:  238 DLARLSLQD-PEYVAVHETASSATPSTLQQHYVVTPLSQKLDVLWSFIRSNLKAKTIVFLSSGKQVRFVYESFRHLQPGIPLMHLHGRQKQGGRLDITAKFSQAKHAVLFSTDITARGLDFPAVDWVIQMDCP-EDADTYIHRVGRTARYER--DGRAVLFLD 396          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_GIBZE (ATP-dependent RNA helicase DBP4 OS=Gibberella zeae GN=DBP4 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.079e-22
Identity = 66/163 (40.49%), Postives = 89/163 (54.60%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS +  P Y+ V +     T   LQQ Y V P  ++   LY F+K NL  K++VF SS   V+F  E  R++Q  +    +HG+QKQ  R      F  A++  L  TDV ARG+D PAVDW++Q D P E  + Y      TA ++  + G A LFLD
Sbjct:  244 DLARLSLKD-PEYVSVHEAAVSATPTNLQQHYIVTPLTEKLDTLYGFIKANLKSKIIVFLSSGKQVRFVYESFRHLQPGIPLLHLHGRQKQGARMEITSRFTAAKQTCLFATDVVARGIDFPAVDWVIQADCP-EDVDTYIHRVGRTARYE--SNGRAVLFLD 402          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_PHANO (ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum GN=DBP4 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 4.021e-22
Identity = 58/135 (42.96%), Postives = 80/135 (59.26%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS Q  P Y+ V       T + LQQ Y + P  ++   L+SF++ +   K++VFFSS  +V+F  E  R++Q  +    IHG+QKQ  R  T   F  A+   L  TDVAARGLD PAVD+++Q D PD+
Sbjct:  244 DLARLSLQD-PEYVSVHAEDKSATPKSLQQNYIICPLEEKLDTLWSFIQASKKSKILVFFSSAKAVRFVYESFRHMQPGIPLLHIHGRQKQGARLDTTAKFSSAKNSCLFATDVAARGLDFPAVDFVIQVDCPDD 377          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_NEUCR (ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa GN=dbp-4 PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.528e-21
Identity = 66/163 (40.49%), Postives = 89/163 (54.60%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS +  P Y+ V +     T  GLQQ Y V P  ++   L+ FL+ NL  K++VF SS   V+F  E  + +Q  +    +HG+QKQ  R      F  A+   L  TDV ARG+D PAVDW++Q D P E  + Y      TA ++  +KG A LFLD
Sbjct:  250 DLARLSLKD-PEYVSVHEAAASATPVGLQQHYIVTPLPEKLDTLWGFLRTNLKSKIIVFMSSGKQVRFVYESFKRMQPGIPLLHLHGRQKQIARLEITNRFTSAKYSCLFATDVVARGVDFPAVDWVIQVDCP-EDADTYIHRVGRTARYE--SKGRAVLFLD 408          
The following BLAST results are available for this feature:
BLAST of EY665182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
DBP4_NEOFI4.750e-2341.10ATP-dependent RNA helicase dbp4 OS=Neosartorya fis... [more]
DBP4_ASPTN4.750e-2341.10ATP-dependent RNA helicase dbp4 OS=Aspergillus ter... [more]
DBP4_ASPFU4.750e-2341.10ATP-dependent RNA helicase dbp4 OS=Aspergillus fum... [more]
DBP4_USTMA6.204e-2342.07ATP-dependent RNA helicase DBP4 OS=Ustilago maydis... [more]
DBP4_EMENI6.204e-2341.72ATP-dependent RNA helicase dbp4 OS=Emericella nidu... [more]
DBP4_CHAGB8.103e-2340.00ATP-dependent RNA helicase DBP4 OS=Chaetomium glob... [more]
DBP4_ASPOR1.382e-2240.49ATP-dependent RNA helicase dbp4 OS=Aspergillus ory... [more]
DBP4_GIBZE3.079e-2240.49ATP-dependent RNA helicase DBP4 OS=Gibberella zeae... [more]
DBP4_PHANO4.021e-2242.96ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria n... [more]
DBP4_NEUCR1.528e-2140.49ATP-dependent RNA helicase dbp-4 OS=Neurospora cra... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665182 ID=EY665182|Name=EY665182|organism=Citrus sinensis|type=EST|length=1045bp
GAGGATCTTGCTCGCTTGTCATTTCAGACAACTCCAGTTTATATTGATGT
GGATGATGGGAGAACTAAGGTCACCAACGAAGGCCTGCAGCAAGGCTATT
GTGTGGTGCCCAGTGCCAAGAGATTTATCCTTCTATATTCCTTCTTGAAG
AGGAATCTGTCAAAGAAAGTGATGGTCTTCTTCTCCTCGTGTAATTCAGT
CAAATTTCATTCAGAACTTCTCAGATATATTCAGGTGGATTGCTTTGATA
TCCATGGAAAGCAAAAGCAACAGAAACGAACCACTACCTTCTTTGACTTC
TGCAAGGCGGAGAAGGGCATCTTGTTGTGTACTGATGTAGCTGCCCGTGG
ACTTGACATTCCTGCTGTGGACTGGATTGTGCAGTATGATCCTCCTGATG
AACCCAAGGAATAATATTCTTCGGGTGGGGTCGGGACAGCCCCGTGGAAG
AAAGGTGCAAAAGGAAATGCCCCACTTTTTCTTGATTCCAGAAAGAATTT
ACATTTTCCTTCCATATTCTGAAGGGCTGGCAAAAATCCCCTGGTTAAAA
AAATTATGAATTTTGAACCAAAAAAAACTGGGTCTAAGGTGCAGTCCCCT
TCCGGGGAAAAAATTGGGTTGGCTAACACCTATTTAATTTTGAAACCAAC
CCCCCCTAAAAATGGCGTTACGCATTTTTTATTTCCATACCAATAGATTT
CCCCACCCCCTAAGAAAGAATAAATCTTCCAAGGTATACCCCCCCCTATT
GATTTGGAAGGGGGAACCCGCCCTCGTTTTTATTTATTGTTTTTTTTTCT
CCCCCCCCCCCTAGAGGGGGAAAAATCCAAACACATAGAAAACCACGCTG
GTCCCCTCTTATAATTTTTTAAAAAAATAAAAAACCACCCCAAAAAAACT
CACACAAAAGAGAACACAAAAACAAATTGGTTTTTTTCTCATTGAAAACA
CTCCACCCCCCTTTTTATTGGAGTGGTAGGAAACAGAAGAAAGAATAATA
AAAAATAAAAATAAAAATACACACCCCCCCCACTTTTGTTTTTAT
back to top