EY665182

Overview
NameEY665182
Unique NameEY665182
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1045
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_VANPO (ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.095e-19
Identity = 58/143 (40.56%), Postives = 80/143 (55.94%), Query Frame = 1
Query:    1 EDLARLSFQT-----TPVYIDVDDGRT--KVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            EDLARLS         P  ++  +G+     T E LQQ Y  V    +  +LYSF+K +L  K++VF SS   V F  E  R +Q  +    +HG+QKQ+ RT T   F +A+   L  TDV ARG+D PA+DW+VQ D P++
Sbjct:  233 EDLARLSLTDYKTIGNPDILNPSNGKVLGPSTPETLQQSYINVELPDKLDMLYSFIKSHLKSKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVARGIDFPAIDWVVQVDCPED 375          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_PICGU (ATP-dependent RNA helicase DBP4 OS=Pichia guilliermondii GN=DBP4 PE=3 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.868e-19
Identity = 54/137 (39.42%), Postives = 77/137 (56.20%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVD-DGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS    P  + V  D       E L+Q Y  +  A +  +L+SFLK +L  K++VFFSS   V+F  E  R +Q  +    ++G+ KQ  R  T   F +A+   L  TD+ ARGLD PA+DW+VQ D P++
Sbjct:  238 KDLARLSL-VNPKRVGVSSDQEVSSIPESLEQYYIKISLASKMDVLWSFLKSHLKSKILVFFSSSKQVQFAYEAFRRLQPGISLLKLYGRHKQTSRLETTMKFSRAQHACLFATDIVARGLDFPAIDWVVQVDCPED 373          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_MAGGR (ATP-dependent RNA helicase DBP4 OS=Magnaporthe grisea GN=DBP4 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.440e-19
Identity = 62/163 (38.04%), Postives = 87/163 (53.37%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS +  P Y+ V    T  T   LQQ Y V P  ++   L+ F+K NL  K++VF SS   V+F  E  R +Q  +    +HG+QKQ  R      F  ++   L  TDV ARG+D   VDW+VQ D P++  + Y      TA +++  +G A +FLD
Sbjct:  242 DLARLSLKD-PEYVSVHAEATTATPSTLQQHYIVTPLPEKLDTLWGFIKANLKSKMVVFLSSGKQVRFVYESFRQMQPGIPLLHMHGRQKQLARLDVTKRFDSSKHACLFATDVIARGIDFTGVDWVVQVDAPEDTDD-YIHRVGRTARYER--EGKAVIFLD 400          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_DICDI (Probable ATP-dependent RNA helicase ddx55 OS=Dictyostelium discoideum GN=ddx55 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.435e-19
Identity = 59/162 (36.42%), Postives = 91/162 (56.17%), Query Frame = 1
Query:   85 LQQGYCVVPSAKRFILLYSFLKRNLSK-KVMVFFSSCNSVKFHSELLRYIQV----DCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHFPSIF*RAGKNPLVKKI 555
            L   Y +VP  +R   L  FL  ++ K K++++F +C++V +  ++L+ ++V      F +HGK    +R   F  F +A  G LL TD+AARGLDIP VDW++QYD P +PK      G  TA  + G  GNA +FL   ++ +    F +  K PLV+ +
Sbjct:  285 LDNRYMIVPVEERLNQLVHFLLNHIDKNKIIIYFLTCSTVDYFFKILQSVKVLSGKPFFSLHGKAPHSQRIKVFDSFSQATNGCLLSTDLAARGLDIPNVDWVLQYDSPQDPKAFVHRIG-RTA--RMGRDGNALIFLSPEEDSYIE--FLKIKKVPLVEMV 441          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_YARLI (ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica GN=DBP4 PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.435e-19
Identity = 60/162 (37.04%), Postives = 80/162 (49.38%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            DLARLS    P YI  +   T  T + L+Q Y  V    +   L+ FL+ +   K++VFFSS   V++  E  R +Q  +    +HGKQKQ  R      F KA    L  TD+ ARG+D PAV W+VQ D P++        G      + G  G A LFL
Sbjct:  232 DLARLSL-ADPKYISANPDTTSSTPKNLEQNYVCVELQDKLDTLWGFLRTHTKFKIIVFFSSSKQVRYVYETFRTLQPGIPLLHLHGKQKQGARMDVVSKFSKASSSCLFATDIVARGIDFPAVHWVVQVDCPEDAATYIHRVGRSA---RFGKSGKALLFL 389          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH49_ARATH (DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 7.098e-19
Identity = 53/138 (38.41%), Postives = 76/138 (55.07%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYI----QVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEP 405
            DLA+   +     I   + ++K T+ GL   Y    + ++   L   L  N +KK++VFF +C  V +   +L  I     +  F  HGK  Q+ R T    F +A  G+LLCTDVAARGLDIP +D++VQYDPP +P
Sbjct:  214 DLAKAGLRNAMEVISGAESKSK-TSSGLYCEYLKCEADQKSSQLVHLLIENKNKKLVVFFMTCACVDYWGLVLSKIPTLKSISFFSTHGKMDQKGRDTALASFTEASSGVLLCTDVAARGLDIPGIDYVVQYDPPQDP 350          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_LODEL (ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus GN=DBP4 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.098e-19
Identity = 53/137 (38.69%), Postives = 77/137 (56.20%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVD-DGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS  T P  I    D       E L Q Y  VP  ++  +L+SF+K +L  K++VFFSS   V++  E  R +Q  +    ++G+ KQ  R  T   F +A+   L  TD+ ARGLD PA+DW++Q D P++
Sbjct:  240 QDLARLSL-TNPKRIGTSSDQDISAIPESLDQYYVKVPLNEKLDVLWSFIKSHLKSKILVFFSSSKQVQYAYETFRTLQPGIPLMKLYGRHKQTSRLETTVKFSQAQHACLFATDIVARGLDFPAIDWVIQVDCPED 375          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH18_ARATH (DEAD-box ATP-dependent RNA helicase 18 OS=Arabidopsis thaliana GN=RH18 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 9.271e-19
Identity = 64/174 (36.78%), Postives = 90/174 (51.72%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDV-----DDGRTKVTNE----GLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYI----QVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            E+LA+   +  PV ++V      +   ++TN     GL   Y    + K+   L   L +N  KK++VFF +C SV +   +L  I     +    IHG  KQ  R      F KA  G LLCTDVAARGLDIP +D++VQYDPP +P   ++     TA  + G +G A +FL
Sbjct:  213 EELAKAGLRN-PVRVEVRAKSKSESSQQLTNSKTPSGLHLEYMECEADKKSSQLVDLLIKNSDKKLIVFFMTCASVDYWGLVLSKIPALKSISLIPIHGDMKQNARDKALASFTKASSGALLCTDVAARGLDIPGIDYVVQYDPPQDPNM-FNHRAGRTA--RLGRQGRAIVFL 382          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_MOUSE (ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=2 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.581e-18
Identity = 55/141 (39.01%), Postives = 83/141 (58.87%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDD-----GRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSE----LLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPP 396
            E+L R   +  PV I V +       T+ T   L+  Y +  + ++F  L  FL+    +K +VFFS+C  V+++ +    LL+ +++ C  IHGK K  KR   F +F K + GIL+CTDV ARG+DIP V+W++QYDPP
Sbjct:  210 ENLVRAGLRN-PVRISVKEKGVAASSTQKTPSRLENHYMICKADEKFNQLVHFLRSRQQEKHLVFFSTCACVEYYGKALEALLKKVKILC--IHGKMKY-KRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPP 346          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_BOVIN (ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=DDX55 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.581e-18
Identity = 55/141 (39.01%), Postives = 84/141 (59.57%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDD-----GRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSE----LLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPP 396
            E+L R   +  PV I V +       T+ T   L+  Y V  + ++F  L  FL+ +  +K +VFFS+C  V+++ +    L++ +++ C  IHGK K  KR   F +F K + GIL+CTDV ARG+DIP V+W++QYDPP
Sbjct:  210 ENLVRAGLRN-PVRISVKEKGVAASSTQKTPSRLENHYMVCKADEKFNQLVHFLRNHKQEKHLVFFSTCACVEYYGKALETLVKGVKIMC--IHGKMKY-KRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPP 346          
The following BLAST results are available for this feature:
BLAST of EY665182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
DBP4_VANPO1.095e-1940.56ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma... [more]
DBP4_PICGU1.868e-1939.42ATP-dependent RNA helicase DBP4 OS=Pichia guillier... [more]
DBP4_MAGGR2.440e-1938.04ATP-dependent RNA helicase DBP4 OS=Magnaporthe gri... [more]
DDX55_DICDI5.435e-1936.42Probable ATP-dependent RNA helicase ddx55 OS=Dicty... [more]
DBP4_YARLI5.435e-1937.04ATP-dependent RNA helicase DBP4 OS=Yarrowia lipoly... [more]
RH49_ARATH7.098e-1938.41DEAD-box ATP-dependent RNA helicase 49 OS=Arabidop... [more]
DBP4_LODEL7.098e-1938.69ATP-dependent RNA helicase DBP4 OS=Lodderomyces el... [more]
RH18_ARATH9.271e-1936.78DEAD-box ATP-dependent RNA helicase 18 OS=Arabidop... [more]
DDX55_MOUSE1.581e-1839.01ATP-dependent RNA helicase DDX55 OS=Mus musculus G... [more]
DDX55_BOVIN1.581e-1839.01ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665182 ID=EY665182|Name=EY665182|organism=Citrus sinensis|type=EST|length=1045bp
GAGGATCTTGCTCGCTTGTCATTTCAGACAACTCCAGTTTATATTGATGT
GGATGATGGGAGAACTAAGGTCACCAACGAAGGCCTGCAGCAAGGCTATT
GTGTGGTGCCCAGTGCCAAGAGATTTATCCTTCTATATTCCTTCTTGAAG
AGGAATCTGTCAAAGAAAGTGATGGTCTTCTTCTCCTCGTGTAATTCAGT
CAAATTTCATTCAGAACTTCTCAGATATATTCAGGTGGATTGCTTTGATA
TCCATGGAAAGCAAAAGCAACAGAAACGAACCACTACCTTCTTTGACTTC
TGCAAGGCGGAGAAGGGCATCTTGTTGTGTACTGATGTAGCTGCCCGTGG
ACTTGACATTCCTGCTGTGGACTGGATTGTGCAGTATGATCCTCCTGATG
AACCCAAGGAATAATATTCTTCGGGTGGGGTCGGGACAGCCCCGTGGAAG
AAAGGTGCAAAAGGAAATGCCCCACTTTTTCTTGATTCCAGAAAGAATTT
ACATTTTCCTTCCATATTCTGAAGGGCTGGCAAAAATCCCCTGGTTAAAA
AAATTATGAATTTTGAACCAAAAAAAACTGGGTCTAAGGTGCAGTCCCCT
TCCGGGGAAAAAATTGGGTTGGCTAACACCTATTTAATTTTGAAACCAAC
CCCCCCTAAAAATGGCGTTACGCATTTTTTATTTCCATACCAATAGATTT
CCCCACCCCCTAAGAAAGAATAAATCTTCCAAGGTATACCCCCCCCTATT
GATTTGGAAGGGGGAACCCGCCCTCGTTTTTATTTATTGTTTTTTTTTCT
CCCCCCCCCCCTAGAGGGGGAAAAATCCAAACACATAGAAAACCACGCTG
GTCCCCTCTTATAATTTTTTAAAAAAATAAAAAACCACCCCAAAAAAACT
CACACAAAAGAGAACACAAAAACAAATTGGTTTTTTTCTCATTGAAAACA
CTCCACCCCCCTTTTTATTGGAGTGGTAGGAAACAGAAGAAAGAATAATA
AAAAATAAAAATAAAAATACACACCCCCCCCACTTTTGTTTTTAT
back to top