EY665182

Overview
NameEY665182
Unique NameEY665182
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1045
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX31_HUMAN (Probable ATP-dependent RNA helicase DDX31 OS=Homo sapiens GN=DDX31 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.697e-18
Identity = 52/133 (39.10%), Postives = 73/133 (54.89%), Query Frame = 1
Query:   79 EGLQQGYCVVPSAKRFILLYSFL----KRNLSKKVMVFFSSCNSVKFHSELLRY------------------IQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE 411
            E L+Q   VVPS  R + L +F+    K    +K++VFFSSC  V+FH  L                     +++    +HG  +Q++RT  F +F  + +G+LLCTDVAARGLD+P V WIVQY+ P  P E
Sbjct:  479 ESLKQHVTVVPSKLRLVCLAAFILQKCKFEEDQKMVVFFSSCELVEFHYSLFLQTLLSSSGAPASGQLPSASMRLKFLRLHGGMEQEERTAVFQEFSHSRRGVLLCTDVAARGLDLPQVTWIVQYNAPSSPAE 611          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_ASHGO (ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii GN=DBP4 PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.697e-18
Identity = 54/138 (39.13%), Postives = 76/138 (55.07%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTK---VTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS         +D   +K    T E L+Q Y  V    +  +L+SF+K +L  K++VF SS   V F  E  R +Q  +    +HG+QKQ  RT T   F +A+   L  TDV ARG+D P+VDW++Q D P++
Sbjct:  234 DLARLSLADYKTVGTMDGPSSKNKPATPENLEQFYIQVALPDKLDILFSFIKSHLKSKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVARGIDFPSVDWVIQTDCPED 371          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_CRYNE (ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans GN=DBP4 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.523e-18
Identity = 56/138 (40.58%), Postives = 78/138 (56.52%), Query Frame = 1
Query:    7 LARLSFQTTPVYIDVDD-GRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSS---CNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            LA+LS    P+YI  +  G   V    L+Q Y VVP  ++   L+ F+K +L  K +VF +S      V+F  E  R +   +    +HGKQKQ  R   F  F  ++  +L+CTDVAARGLD PAVDW++Q D PD+
Sbjct:  263 LAKLSLYE-PLYISCNKPGEEGVMPANLEQYYAVVPLERKLDALWGFVKSHLKMKGIVFVTSGKQARRVRFIFETFRRLHPGLPLMHLHGKQKQPTRLDIFQRFSSSKSALLICTDVAARGLDFPAVDWVIQLDCPDD 399          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_HUMAN (ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 1.025e-17
Identity = 53/141 (37.59%), Postives = 83/141 (58.87%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDD-----GRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSE----LLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPP 396
            E+L R   +  PV + V +        + T   L+  Y V  + ++F  L  FL+ +  +K +VFFS+C  V+++ +    L++ +++ C  IHGK K  KR   F +F K + GIL+CTDV ARG+DIP V+W++QYDPP
Sbjct:  210 ENLVRAGLRN-PVRVSVKEKGVAASSAQKTPSRLENYYMVCKADEKFNQLVHFLRNHKQEKHLVFFSTCACVEYYGKALEVLVKGVKIMC--IHGKMKY-KRNKIFMEFRKLQSGILVCTDVMARGIDIPEVNWVLQYDPP 346          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH32_ARATH (DEAD-box ATP-dependent RNA helicase 32 OS=Arabidopsis thaliana GN=RH32 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.339e-17
Identity = 53/137 (38.69%), Postives = 78/137 (56.93%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDI-PAVDWIVQYDPPDE 402
            +DLARLS +  P YI V       T   L Q   +VP  K+  +L+SF+K +L+ +++VF S+   VKF  E    ++  +    +HGK  Q+KR   +  F +  + +L CTDV ARGLD   AVDW+VQ D P++
Sbjct:  264 KDLARLSLRD-PEYISVHAEAVTATPTSLMQTVMIVPVEKKLDMLWSFIKTHLNSRILVFLSTKKQVKFVHEAFNKLRPGIPLKSLHGKMSQEKRMGVYSQFIE-RQSVLFCTDVLARGLDFDKAVDWVVQVDCPED 398          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_CHICK (ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.339e-17
Identity = 54/139 (38.85%), Postives = 79/139 (56.83%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEG-----LQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYI--QVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPP 396
            E+L R   +  PV I V +     TN       L+  Y +  + ++F  L  FL+++  +K +VFFS+C  V+++ + L  +  QV    IHGK K  KR   F +F +   GIL+CTDV ARG+DIP V W++QYDPP
Sbjct:  210 ENLVRAGLRN-PVRISVKEKGVAATNTQKTPTRLENYYMICKADEKFNQLVHFLRQHKQEKHLVFFSTCACVEYYGKALESLIKQVKIMCIHGKMKH-KRNKIFTEFRRLAGGILVCTDVMARGIDIPEVHWVLQYDPP 346          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_XENLA (ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.748e-17
Identity = 50/115 (43.48%), Postives = 73/115 (63.48%), Query Frame = 1
Query:   64 TKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSE----LLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPP 396
            T+ T   LQ  Y +  + ++F  L +FL++   +K +VFFS+C  V+++ +    LL+ ++V C  IHGK K  KR   F +F K   GIL+CTDV ARG+DI  V+W+VQYDPP
Sbjct:  235 TQKTPIRLQNYYMICKADEKFNKLIAFLQKRKQEKHLVFFSTCACVEYYGKALEMLLKPVKVMC--IHGKMKH-KRNRIFTEFRKINSGILVCTDVMARGIDIHEVNWVVQYDPP 346          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX55_DANRE (ATP-dependent RNA helicase DDX55 OS=Danio rerio GN=ddx55 PE=2 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 2.982e-17
Identity = 54/137 (39.42%), Postives = 81/137 (59.12%), Query Frame = 1
Query:   85 LQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSE----LLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            L   Y +  + ++F  L +FL+++  +K +VFFS+C  V++  +    L++ + + C  IHGK K  KR   F DF   + GIL+CTDV ARG+DIP V+W++QYDPP          G  TA  + G +GNA +FL
Sbjct:  242 LSNYYTMCRAEEKFNTLVAFLRQHKHEKQLVFFSTCACVEYFGKALEVLVKNVSIHC--IHGKMKH-KRNKIFADFRALKSGILVCTDVMARGIDIPEVNWVLQYDPPSSASSFVHRCG-RTA--RIGNQGNALVFL 372          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH32_ORYSJ (DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sativa subsp. japonica GN=Os07g0517000 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 8.677e-17
Identity = 50/135 (37.04%), Postives = 80/135 (59.26%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPD 399
            +DLAR+S +  P YI V +  T  T + L+Q   +VP  ++  +L+SF+KR+L  +++VF SS   VKF  E+ + ++  +    +HG+ K + +     +F K    +L  TD+ ARGLDI  VDW+VQ D P+
Sbjct:  274 KDLARVSLKD-PEYISVHEEATTATPDTLEQYAMIVPLEQKLNMLWSFIKRHLKSRILVFLSSVKQVKFVYEVFKKLRPGISLRCMHGRMKYEVQQAIVAEF-KEGHSVLFSTDIFARGLDIEDVDWVVQVDCPE 406          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: RH18_ORYSJ (DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.480e-16
Identity = 47/112 (41.96%), Postives = 63/112 (56.25%), Query Frame = 1
Query:   82 GLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQV----DCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEP 405
            GL+  Y +  ++ +   L  FL +N  KK+MV+F++C  V + + +L  +           HGK KQ  R      F     GIL+CTDVAARGLDIP VD IVQYDPP +P
Sbjct:  258 GLRLEYMICEASNKSSQLVDFLVQNNGKKIMVYFATCACVDYWAIVLPLLDSLKGSPIIPYHGKMKQGPREKALASFSALSSGILVCTDVAARGLDIPHVDLIVQYDPPQDP 369          
The following BLAST results are available for this feature:
BLAST of EY665182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
DDX31_HUMAN2.697e-1839.10Probable ATP-dependent RNA helicase DDX31 OS=Homo ... [more]
DBP4_ASHGO2.697e-1839.13ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii... [more]
DBP4_CRYNE3.523e-1840.58ATP-dependent RNA helicase DBP4 OS=Cryptococcus ne... [more]
DDX55_HUMAN1.025e-1737.59ATP-dependent RNA helicase DDX55 OS=Homo sapiens G... [more]
RH32_ARATH1.339e-1738.69DEAD-box ATP-dependent RNA helicase 32 OS=Arabidop... [more]
DDX55_CHICK1.339e-1738.85ATP-dependent RNA helicase DDX55 OS=Gallus gallus ... [more]
DDX55_XENLA1.748e-1743.48ATP-dependent RNA helicase DDX55 OS=Xenopus laevis... [more]
DDX55_DANRE2.982e-1739.42ATP-dependent RNA helicase DDX55 OS=Danio rerio GN... [more]
RH32_ORYSJ8.677e-1737.04DEAD-box ATP-dependent RNA helicase 32 OS=Oryza sa... [more]
RH18_ORYSJ1.480e-1641.96DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665182 ID=EY665182|Name=EY665182|organism=Citrus sinensis|type=EST|length=1045bp
GAGGATCTTGCTCGCTTGTCATTTCAGACAACTCCAGTTTATATTGATGT
GGATGATGGGAGAACTAAGGTCACCAACGAAGGCCTGCAGCAAGGCTATT
GTGTGGTGCCCAGTGCCAAGAGATTTATCCTTCTATATTCCTTCTTGAAG
AGGAATCTGTCAAAGAAAGTGATGGTCTTCTTCTCCTCGTGTAATTCAGT
CAAATTTCATTCAGAACTTCTCAGATATATTCAGGTGGATTGCTTTGATA
TCCATGGAAAGCAAAAGCAACAGAAACGAACCACTACCTTCTTTGACTTC
TGCAAGGCGGAGAAGGGCATCTTGTTGTGTACTGATGTAGCTGCCCGTGG
ACTTGACATTCCTGCTGTGGACTGGATTGTGCAGTATGATCCTCCTGATG
AACCCAAGGAATAATATTCTTCGGGTGGGGTCGGGACAGCCCCGTGGAAG
AAAGGTGCAAAAGGAAATGCCCCACTTTTTCTTGATTCCAGAAAGAATTT
ACATTTTCCTTCCATATTCTGAAGGGCTGGCAAAAATCCCCTGGTTAAAA
AAATTATGAATTTTGAACCAAAAAAAACTGGGTCTAAGGTGCAGTCCCCT
TCCGGGGAAAAAATTGGGTTGGCTAACACCTATTTAATTTTGAAACCAAC
CCCCCCTAAAAATGGCGTTACGCATTTTTTATTTCCATACCAATAGATTT
CCCCACCCCCTAAGAAAGAATAAATCTTCCAAGGTATACCCCCCCCTATT
GATTTGGAAGGGGGAACCCGCCCTCGTTTTTATTTATTGTTTTTTTTTCT
CCCCCCCCCCCTAGAGGGGGAAAAATCCAAACACATAGAAAACCACGCTG
GTCCCCTCTTATAATTTTTTAAAAAAATAAAAAACCACCCCAAAAAAACT
CACACAAAAGAGAACACAAAAACAAATTGGTTTTTTTCTCATTGAAAACA
CTCCACCCCCCTTTTTATTGGAGTGGTAGGAAACAGAAGAAAGAATAATA
AAAAATAAAAATAAAAATACACACCCCCCCCACTTTTGTTTTTAT
back to top