CX671278

Overview
NameCX671278
Unique NameCX671278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:67..782. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 7.439e-87
Identity = 150/178 (84.27%), Postives = 161/178 (90.45%), Query Frame = 2
Query:  113 NGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAF 646
            NGGR+SMR+T   +  S   WYGPDR KYLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA+NGVKFGEAVWFKAG+QIF EGGLDYLGNP+L+HAQSILAIWACQVVLMGAVEGYR+ GGPLGE  D LYPGG+FDPLGLA+DPEAF
Sbjct:   30 NGGRVSMRRTIKSAPES--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF 205          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2_MALDO (Chlorophyll a-b binding protein AB10, chloroplastic OS=Malus domestica PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 8.512e-83
Identity = 161/216 (74.54%), Postives = 172/216 (79.63%), Query Frame = 2
Query:   68 VGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            + K   L P  + L      +M K  +KS  S S      RVKYLGP SGE PSYLTGEFPGDYGWDTAGLSA PETFAKNRELEVIH R AM  ALGC+FPELL+  G  FGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIW  +V+LMGAVEGYRIA GPLGEVTDPLYP GSFD LGLA+D EAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   20 IAKPSKLNPISSTLIVTAGFTMLKHAAKSKVSSSTC--DRRVKYLGPFSGEWPSYLTGEFPGDYGWDTAGLSAYPETFAKNRELEVIHSRCAMSAALGCIFPELLSVMGQGFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWTTKVILMGAVEGYRIARGPLGEVTDPLYP-GSFDSLGLAEDTEAFAELKVKELKNGRLAMFSMFGFFV 232          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2_CHLRE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas reinhardtii GN=cabII-1 PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.896e-82
Identity = 149/198 (75.25%), Postives = 167/198 (84.34%), Query Frame = 2
Query:  134 RKTGSKSV---SSGSPWYGPDRVKYLGPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            +KT +K+    SSG  +YGP+R K+LGP S    P+YLTGEFPGDYGWDTAGLSADPETF + RELE+IH RWAMLGALGC  PELLA++G KFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQ+I+A  A QV+LMG +EGYR+ GGP GE  DPLYPG SFDPLGLADDP+ FAELK KEIKNGRLA FSMFGFFV
Sbjct:   20 KKTAAKAAAPKSSGVEFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRELELIHARWAMLGALGCQTPELLAKSGTKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQNIVATSAVQVILMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLASFSMFGFFV 217          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 4.671e-81
Identity = 146/187 (78.07%), Postives = 159/187 (85.03%), Query Frame = 2
Query:  158 SSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARN-GVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            S+G  WYGPDR K+LGP S   P+YLTGEFPGDYGWDTAGLSADPETF K RELEVIH RWA+LGALG + PELL+   GVKFGE VWFKAGAQIFSEGGLDYLG+P+LIHAQ+I+A  A QVVLMG +EGYR+ GGP GE  DPLYPG SFDPLGLADDP+ FAELK KEIKNGRLAMFS FGFFV
Sbjct:   34 SAGIEWYGPDRAKWLGPFSTNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVLMGLIEGYRVNGGPAGEGLDPLYPGESFDPLGLADDPDTFAELKVKEIKNGRLAMFSCFGFFV 220          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_SOLLC (Chlorophyll a-b binding protein 13, chloroplastic OS=Solanum lycopersicum GN=CAB13 PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 9.115e-77
Identity = 150/220 (68.18%), Postives = 168/220 (76.36%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGP-LGEVTDPLYPGGS-FDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F+G+  N  P  + ++ G         ++   S   WYGPDRVKYLGP S + PSYL GEFPGDYGWDTAGLSADPE FAKNR LEVIH RWAMLGALGC+FPE+L +   V F E VWFKAG+QIFS+GGLDYLGNP+L+HAQSILA+   QVVLMG VEG+RI G P +GE  D LYPGG  FDPLGLADDP  FAELK KEIKNGRLAMFSMFGFFV
Sbjct:   19 FLGQTKNANPLRDVVAMGS--------ARFTMSNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCIFPEVLEKWVKVDFKEPVWFKAGSQIFSDGGLDYLGNPNLVHAQSILAVLGFQVVLMGLVEGFRINGLPGVGEGND-LYPGGQYFDPLGLADDPTTFAELKVKEIKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_HORVU (Chlorophyll a-b binding protein of LHCII type III, chloroplastic OS=Hordeum vulgare GN=LHBC PE=2 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.555e-76
Identity = 151/219 (68.95%), Postives = 169/219 (77.17%), Query Frame = 2
Query:   71 GKAVNLAPSGN-ELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAG-GPLGEVTDPLYPGGS-FDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            G+A + +P  +   +  GRI+M             WYGPDRVKYLGP S + PSYL GEFPGDYGWDTAGLSADPE FA+NR LEVIH RWAMLGALGCVFPE+L +  GV+F E VWFKAG+QIFSEGGLDYLGNP+L+HAQSILA+   QV+LMG VEG+RI G   +GE  D LYPGG  FDPLGLADDP  FAELK KEIKNGRLAMFSMFGFFV
Sbjct:   24 GRAASASPLRDIAAATNGRITM---------GNDLWYGPDRVKYLGPFSAQTPSYLNGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCVFPEVLQKWVGVEFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVEGFRINGLDGVGEGND-LYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFV 232          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.665e-70
Identity = 133/185 (71.89%), Postives = 151/185 (81.62%), Query Frame = 2
Query:  173 WYGPDRVKYLGPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAR-NGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLG--EVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            +YGPDR K+LGP S  + P YLTGEFPGDYGWDTAGLSADP+TFA+ RE+E+IH RWA+LGALG + PELL++  GV+FGE VWFKAGAQIF++GGL+YLGN SLIHAQSI+A  A QVVLMG  E YR  GG  G  +  D LYPGG FDPLGLADDP+ FAELK KEIKNGRLAMFS  GFFV
Sbjct:   33 FYGPDRAKFLGPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVLMGLAEAYRANGGSEGFLDDLDTLYPGGPFDPLGLADDPDTFAELKVKEIKNGRLAMFSCLGFFV 217          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2_DUNSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella salina PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.193e-68
Identity = 134/195 (68.72%), Postives = 152/195 (77.95%), Query Frame = 2
Query:  137 KTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLA-RNGVKFGEA-VWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            K  SKS SS + +YGPD       L  + P   TGEFPGDYGWDTAGLSADPETF + RELE+IH R  +LGALG V PELLA  +G+KFG+A +WFKAGA IF +GGL+YLGNPSLIHAQ+I+A  A QVVLMG VEGYR+ GGP GE  DPLYPG +FDPLGLADDP+ FAELK KEIKNGRLAMF+  GFFV
Sbjct:   45 KAVSKSSSSANQFYGPDATSGWD-LQHQHPRLPTGEFPGDYGWDTAGLSADPETFKRYRELELIHARCGLLGALGMVTPELLADEDGIKFGDAAIWFKAGAAIFQDGGLNYLGNPSLIHAQNIVATLAVQVVLMGLVEGYRVNGGPAGEGLDPLYPGEAFDPLGLADDPDTFAELKVKEIKNGRLAMFACLGFFV 238          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_PINSY (Chlorophyll a-b binding protein type 2 member 2 (Fragment) OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 6.357e-54
Identity = 101/114 (88.60%), Postives = 106/114 (92.98%), Query Frame = 2
Query:  374 ELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            ELL +NGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQVVLMG +EGYR+ GGPLGE  DPLYPG +FDPLGLADDPEA AELK KEIKNGRLAMFSMFGFFV
Sbjct:    1 ELLVKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGPLGEGLDPLYPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFV 114          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 8.611e-43
Identity = 105/198 (53.03%), Postives = 122/198 (61.62%), Query Frame = 2
Query:  146 SKSVSSGSP----WYGPDRVKYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            SK+VS  S     WYGPDR  +L  G L   E P YL GE  GDYG+D  GL   PE FAK +  E+IH RWAMLGA G + PE L + G   G EAVWFK GA +     L+Y G    I    +LA+ A +VVL+G  E YRI  G   +  D L+PGG FDPLGLA DPE  A LK KEIKNGRLAMF+M GFF+
Sbjct:   49 SKAVSETSDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKN--IPINLVLAVVA-EVVLLGGAEYYRITNGL--DFEDKLHPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFI 241          
The following BLAST results are available for this feature:
BLAST of CX671278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB21_SILPR7.439e-8784.27Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB2_MALDO8.512e-8374.54Chlorophyll a-b binding protein AB10, chloroplasti... [more]
CB2_CHLRE1.896e-8275.25Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_CHLMO4.671e-8178.07Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_SOLLC9.115e-7768.18Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB23_HORVU1.555e-7668.95Chlorophyll a-b binding protein of LHCII type III,... [more]
CB2_DUNTE1.665e-7071.89Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2_DUNSA1.193e-6868.72Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB22_PINSY6.357e-5488.60Chlorophyll a-b binding protein type 2 member 2 (F... [more]
CB26_ARATH8.611e-4353.03Chlorophyll a-b binding protein CP26, chloroplasti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A12_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A12-A24-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671278 ID=CX671278|Name=CX671278|organism=Citrus sinensis|type=EST|length=716bp
CACAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCGACCATGG
CTCTCTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTGCCCCTTCAGGC
AATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAGCAA
GTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGTACT
TGGGCCCACTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTCCCT
GGTGACTACGGTTGGGACACTGCTGGGCTTTCAGCTGACCCAGAAACCTT
TGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGTTGG
GAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTCAAG
TTCGGTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAGATCTTCAGCGAGGG
CGGGCTTGACTACTTGGGGAACCCAAGCCTGATCCACGCTCAGAGCATCT
TGGCCATCTGGGCTTGCCAGGTGGTCTTGATGGGAGCCGTTGAGGGTTAC
AGAATTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCCAGG
TGGCAGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTGCTG
AGCTCAAGGGTAAGGAAATCAAGAATGGAAGGTTGGCTATGTTCTCCATG
TTTGGTTTCTTCGTTC
back to top