CX671267

Overview
NameCX671267
Unique NameCX671267
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length539
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7745 contig Csv1_Contig7745:67..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671267 vs. ExPASy Swiss-Prot
Match: RL37_CAEEL (60S ribosomal protein L37 OS=Caenorhabditis elegans GN=rpl-37 PE=2 SV=2)

HSP 1 Score: 117.472 bits (293), Expect = 4.144e-26
Identity = 52/82 (63.41%), Postives = 64/82 (78.05%), Query Frame = 3
Query:   27 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFREGT 272
            M KGT +FGK+  K+HTLC RCG+ SFH+QK RCA+C Y  A+KRTYNW  K+IRR+TTGTGR R+LR V  RF++GFR  T
Sbjct:    1 MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTGTGRTRHLRDVNARFRNGFRGTT 82          
BLAST of CX671267 vs. ExPASy Swiss-Prot
Match: RL37_LEIIN (60S ribosomal protein L37 OS=Leishmania infantum GN=RPL37 PE=3 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 2.514e-23
Identity = 49/79 (62.03%), Postives = 59/79 (74.68%), Query Frame = 3
Query:   27 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFR 263
            M KGT S G+R  +TH LC RCGR S+H+Q  RCAACAYP A +R YNWSVKAI+R+ TGTGR RYL+ V RR  + F+
Sbjct:    1 MTKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSVKAIKRRRTGTGRCRYLKVVNRRIANHFK 79          
BLAST of CX671267 vs. ExPASy Swiss-Prot
Match: RL37_LEIDO (60S ribosomal protein L37 OS=Leishmania donovani GN=RPL37 PE=3 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 2.514e-23
Identity = 49/79 (62.03%), Postives = 59/79 (74.68%), Query Frame = 3
Query:   27 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFR 263
            M KGT S G+R  +TH LC RCGR S+H+Q  RCAACAYP A +R YNWSVKAI+R+ TGTGR RYL+ V RR  + F+
Sbjct:    1 MTKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSVKAIKRRRTGTGRCRYLKVVNRRIANHFK 79          
BLAST of CX671267 vs. ExPASy Swiss-Prot
Match: RL37_SOLLC (60S ribosomal protein L37 (Fragment) OS=Solanum lycopersicum GN=RPL37 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.796e-20
Identity = 43/51 (84.31%), Postives = 48/51 (94.12%), Query Frame = 3
Query:  123 RCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFREGTQ 275
            RC+ACAYPAAR R YNWSVKA+RRKTTGTGRMRYLR+VPRRFK+ FREGT+
Sbjct:    2 RCSACAYPAARLRKYNWSVKALRRKTTGTGRMRYLRNVPRRFKTNFREGTE 52          
BLAST of CX671267 vs. ExPASy Swiss-Prot
Match: RL37_ENCCU (60S ribosomal protein L37 OS=Encephalitozoon cuniculi GN=RPL37 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 8.660e-16
Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 3
Query:   27 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFR 263
            M KGT SFGK+  +   +C RCGR+S+H QK+ C++C YP  + R    S+KA RR+T GTGRMRY++   R  K+G +
Sbjct:    1 MSKGTASFGKKNKRNTEMCRRCGRQSYHKQKNSCSSCGYPNPKMRNPG-SIKARRRRTIGTGRMRYMKRELRAAKNGHK 78          
BLAST of CX671267 vs. ExPASy Swiss-Prot
Match: RL37_METKA (50S ribosomal protein L37e OS=Methanopyrus kandleri GN=rpl37e PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.918e-11
Identity = 31/59 (52.54%), Postives = 41/59 (69.49%), Query Frame = 3
Query:   27 MGKGTGSFGKR-RNKTHTLCVRCGRRSFHLQKSRCAACAYPAARK-RTYNWSVKAIRRK 197
            M KGT SFGKR + KTH  C RCGRR++H++K  CAAC +  +R+ R Y+W  K + RK
Sbjct:    1 MAKGTPSFGKRNKTKTHVRCRRCGRRAYHVRKGYCAACGFGRSRRIRRYSWQNKKVNRK 59          
The following BLAST results are available for this feature:
BLAST of CX671267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
RL37_CAEEL4.144e-2663.4160S ribosomal protein L37 OS=Caenorhabditis elegan... [more]
RL37_LEIIN2.514e-2362.0360S ribosomal protein L37 OS=Leishmania infantum G... [more]
RL37_LEIDO2.514e-2362.0360S ribosomal protein L37 OS=Leishmania donovani G... [more]
RL37_SOLLC5.796e-2084.3160S ribosomal protein L37 (Fragment) OS=Solanum ly... [more]
RL37_ENCCU8.660e-1648.1060S ribosomal protein L37 OS=Encephalitozoon cunic... [more]
RL37_METKA4.918e-1152.5450S ribosomal protein L37e OS=Methanopyrus kandler... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A05_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A05-A10-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671267 ID=CX671267|Name=CX671267|organism=Citrus sinensis|type=EST|length=539bp
CTTTCCTCTGCTTCGCATACGCTTCGATGGGTAAGGGAACAGGGAGTTTC
GGTAAGAGGAGAAACAAGACACACACTTTGTGTGTGCGATGTGGCCGTCG
CAGCTTCCATCTTCAGAAGAGTCGTTGCGCTGCTTGTGCTTACCCCGCTG
CTCGCAAGAGAACGTATAACTGGAGTGTGAAGGCAATCCGAAGAAAGACC
ACTGGAACCGGCAGGATGAGGTATCTGCGCCATGTACCTCGCAGGTTCAA
GAGCGGCTTCAGAGAAGGTACTCAGGCAGCACCAAGGAAGAAGGGAGCGG
CTGCCTCTGCTTAAGGAGTTGAAGGGTAATTTTGGGCGTGAATCAGCACC
TCATTATAGATTTAGTCTTCTTTAATGTGTGGAGACAAGATTCATGGGAA
CATAATTTTGAAAAAGGATGTTATTTGTTTTTGTGCTTAGTTGTTTTCAA
TTATGATTACTCTGTAGTCTTTTTCAATTTTGGACAAGATGAATGAGTTT
ATTGTTGTTTGACCTCCTTTNANAAAAAAAAAAAAAAAA
back to top