CX671264

Overview
NameCX671264
Unique NameCX671264
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5039 contig Csv1_Contig5039:592..1408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B2_HUMAN (Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Homo sapiens GN=SLC35B2 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.222e-13
Identity = 52/202 (25.74%), Postives = 97/202 (48.02%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLA---DAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++ K++KV+PVM+MG  +   RR Y   EY              L+   + ++SP  ++ G+I+++G +  DSF  N Q+A+F     + QM  +F          +  +L  G L +      +H       +  ++ +  GQ+ +   I  FGAA   ++ T R+A  +LLS L++   +T   G G+ ++   + L++
Sbjct:  212 QVLAKASKVIPVMLMGKLVS--RRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSVQM--MFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRV 409          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B2_PONAB (Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Pongo abelii GN=SLC35B2 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.163e-12
Identity = 52/202 (25.74%), Postives = 96/202 (47.52%), Query Frame = -3
Query:  216 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLA---DAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKL 812
            Q++ K +KV+PVM+MG  +   RR Y   EY              L+   + ++SP  ++ G+I+++G +  DSF  N Q+A+F     + QM  +F          +  +L  G L +      +H       +  ++ +  GQ+ +   I  FGAA   ++ T R+A  +LLS L++   +T   G G+ ++   + L++
Sbjct:  212 QVLAKVSKVIPVMLMGKLVS--RRSYEHWEYLTATLISIGVSMFLLSSGPEPRSSPATTLSGLILLAGYIAFDSFTSNWQDALFAYKMSSVQM--MFGVNFFSCLFTVGSLLEQGALLEGTRFMGRHSEFAAHALLLSICSACGQLFIFYTIGQFGAAVFTIIMTLRQAFAILLSCLLYGHTVTVVGGLGVAVVFAALLLRV 409          
BLAST of CX671264 vs. ExPASy Swiss-Prot
Match: S35B2_DICDI (Adenosine 3'-phospho 5'-phosphosulfate transporter 1 OS=Dictyostelium discoideum GN=slc35b2 PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.194e-11
Identity = 54/196 (27.55%), Postives = 93/196 (47.45%), Query Frame = -3
Query:  240 QLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYXXXXXXXXXXXXXXLAD--AQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLF---CSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLI 812
            Q + K  K+LPVM++G FI G  +KY   +Y              L    +    + +  G+I+++  +  DSF    QE +F     +T  +M++   CS+++ + +LI    L G LF A    S H  V+      + +  +GQ+ +   I  FGA   + +   R+ V+++LS LI+  PL+     G LL+
Sbjct:  129 QTLGKCGKMLPVMLVGTFISG--KKYGLKDYSIALTITTGCMIFFLTGKISNNESSNTSYGIILMALYMFFDSFTSTFQEKMFKGYTMSTYDQMIYVNGCSSIISVFILI----LNGRLFPAIEFISTHNGVFFDSTMLSASAGLGQMVIYYTIKEFGALVFSTIMVTRQMVSIILSTLIYLHPLSNTQWIGALLV 318          
The following BLAST results are available for this feature:
BLAST of CX671264 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
S35B2_HUMAN5.222e-1325.74Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B2_PONAB1.163e-1225.74Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]
S35B2_DICDI2.194e-1127.55Adenosine 3'-phospho 5'-phosphosulfate transporter... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A04_b Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A04-A8-6.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671264 ID=CX671264|Name=CX671264|organism=Citrus sinensis|type=EST|length=817bp
TTTTTTTTTTTTTTTTACTAGTAATTATTTCTTCTGTTTGCTGGTGAAAC
AAGAAACAAAGAAATACATTGTTCATTAGAAAAATTTCTTAAAATTTAGA
CCGGTGCTCTTTTTTCTTCATCTGCTTCTTCACGTTCACTAAAAGATAGT
TTCCGAATGTTGACTTTGAAAGATGATGTTGCAGTTCTCTTGATGGGTTT
GTCATCTGCAGGCAAGAGTTTCAATGTGATGCCCATTGCTATTAGCAGAA
GTCCAGTCCCATGCTGTTCAGTTAATGGCTTTGTGAATATCAAGTATGAC
AATAGTAATGTTACTGCCTTTCTTGCCGTTGTCACCATAGCTGTTGTAGC
AGCACCAAACAGGGCAATGAGGGAAAGGACTGAAACTTGGCCGATAAAGG
TGGCCATGGCTTCAAAGACCAGCACACCGTAAACGTATAGATGCTGAGAG
CAAGAATTCCATGCTTTAAATAACTCCCCTGTCAAAAGCATTGGAGGAAT
CAACATTGGCAAACCGACCACGGTCGAGCAAAACAGCATCTCCATCTGGG
TGGTTTCAGGGTTCATGGTAAAGATGGCTTCTTGCAAATTTCCAAGAAAA
GAATCCATTATTAGAGCACCAGAAATCATGATAACGCCAATCATGCTGAA
ATTTGGGGAAGTTTGTGCATCGGCTAAGGTAAAAAGGATCAATCCCACAA
CTAAAAGTAATGCAGATACATATTCGTGAGCTGGGTATTTTCGCCTGAGG
CCTGGTATGAAGGCTCCCATGACCATCACAGGCAAAACCTTGGTGGATTT
GAACATAAGCTGTGCAG
back to top