GO241389

Overview
NameGO241389
Unique NameGO241389
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5655 contig Csv1_Contig5655:306..917. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX16_ORYSI (Homeobox-leucine zipper protein HOX16 OS=Oryza sativa subsp. indica GN=HOX16 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 6.710e-32
Identity = 72/130 (55.38%), Postives = 94/130 (72.31%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNK-ETEGSCSIEV 388
            E+++ D+  Q  EKKRRL  EQV  LE++FE  NKLEPERK +LAR LGLQPRQVA+WFQNRRARWKTKQLE+D+D LK  ++A++AD +AL   N +LH+++M+L     TE +   +  TEGS    V
Sbjct:   68 EEEYYDE--QLPEKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQNRRARWKTKQLERDFDRLKASFDALRADHDALLQDNHRLHSQVMSL-----TEKLQEKETTTEGSAGAAV 190          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HAT5_ARATH (Homeobox-leucine zipper protein HAT5 OS=Arabidopsis thaliana GN=HAT5 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 8.764e-32
Identity = 71/121 (58.68%), Postives = 88/121 (72.73%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKET 364
            +DDF DD  Q  EKKRRL  EQV  LEK+FE  NKLEPERK QLA+ LGLQPRQVA+WFQNRRARWKTKQLE+DYDLLK  Y+ + ++ +++   N KL +E+ +L     TE +   +ET
Sbjct:   57 DDDFYDD--QLPEKKRRLTTEQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSL-----TEKLQGKQET 170          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: ATB16_ARATH (Homeobox-leucine zipper protein ATHB-16 OS=Arabidopsis thaliana GN=ATHB-16 PE=2 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.145e-31
Identity = 71/121 (58.68%), Postives = 90/121 (74.38%), Query Frame = 2
Query:   38 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKE--TEGSCSIEVRQ 394
            EKKRRL ++QVK LEKNFEL NKLEPERK +LA+ LGLQPRQVA+WFQNRRARWKTKQLEKDY +LK QY++++ + ++L+  N  L  EI  +K++   E  N N +  TEG    EV +
Sbjct:   58 EKKRRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKGQYDSLRHNFDSLRRDNDSLLQEISKIKAKVNGEEDNNNNKAITEGVKEEEVHK 178          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX20_ORYSJ (Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.495e-31
Identity = 65/102 (63.73%), Postives = 81/102 (79.41%), Query Frame = 2
Query:   23 GSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSR 328
            G   GEKKRRL++EQV+ LE++FE  NKLEPERK +LAR LGLQPRQVA+WFQNRRARWKTKQLE+DY  L++ Y+A++AD +AL+     L AEI  LK +
Sbjct:   37 GGGGGEKKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKELKGK 138          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX20_ORYSI (Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. indica GN=HOX20 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.495e-31
Identity = 65/102 (63.73%), Postives = 81/102 (79.41%), Query Frame = 2
Query:   23 GSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSR 328
            G   GEKKRRL++EQV+ LE++FE  NKLEPERK +LAR LGLQPRQVA+WFQNRRARWKTKQLE+DY  L++ Y+A++AD +AL+     L AEI  LK +
Sbjct:   37 GGGGGEKKRRLSVEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRQSYDALRADHDALRRDKDALLAEIKELKGK 138          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: ATHB6_ARATH (Homeobox-leucine zipper protein ATHB-6 OS=Arabidopsis thaliana GN=ATHB-6 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.495e-31
Identity = 70/123 (56.91%), Postives = 90/123 (73.17%), Query Frame = 2
Query:   38 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSR-------EVTESINLNKETEGSCSIE 385
            EKKRRL++ QVK LEKNFEL NKLEPERK++LA+ LGLQPRQVA+WFQNRRARWKTKQLEKDY +LK QY++++ + ++L+  N+ L  EI  LK++       E  E  N    TE   S++
Sbjct:   61 EKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISKLKTKLNGGGGEEEEEENNAAVTTESDISVK 183          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX5_ORYSJ (Homeobox-leucine zipper protein HOX5 OS=Oryza sativa subsp. japonica GN=HOX5 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.266e-30
Identity = 68/131 (51.91%), Postives = 93/131 (70.99%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKETEGSCSIEVRQ 394
            E+++ D+  QA EKKRRL  EQV+ LE++FE  NKLEPERK +LAR LG+ PRQVA+WFQNRRARWKTKQLE D+D LK  Y+A+ AD  AL + N +L A++++L  +   +  + +  T  + + EV Q
Sbjct:   75 EEEYYDE--QAPEKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHHALLSDNDRLRAQVISLTEKLQDKETSPSSATITTAAQEVDQ 203          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX5_ORYSI (Homeobox-leucine zipper protein HOX5 OS=Oryza sativa subsp. indica GN=HOX5 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.266e-30
Identity = 68/131 (51.91%), Postives = 93/131 (70.99%), Query Frame = 2
Query:    2 EDDFSDDGSQAGEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSREVTESINLNKETEGSCSIEVRQ 394
            E+++ D+  QA EKKRRL  EQV+ LE++FE  NKLEPERK +LAR LG+ PRQVA+WFQNRRARWKTKQLE D+D LK  Y+A+ AD  AL + N +L A++++L  +   +  + +  T  + + EV Q
Sbjct:   75 EEEYYDE--QAPEKKRRLTAEQVQMLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLEHDFDRLKAAYDALAADHHALLSDNDRLRAQVISLTEKLQDKETSPSSATITTAAQEVDQ 203          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX4_ORYSJ (Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. japonica GN=HOX4 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.159e-30
Identity = 62/98 (63.27%), Postives = 80/98 (81.63%), Query Frame = 2
Query:   35 GEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSR 328
            GEKKRRL++EQV+ LE++FE+ NKLEPERK +LAR LGLQPRQVA+WFQNRRARWKTKQLE+DY  L+  Y++++ D +AL+     L AEI  LK++
Sbjct:   49 GEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAK 146          
BLAST of GO241389 vs. ExPASy Swiss-Prot
Match: HOX4_ORYSI (Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. indica GN=HOX4 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.159e-30
Identity = 62/98 (63.27%), Postives = 80/98 (81.63%), Query Frame = 2
Query:   35 GEKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDLLKRQYEAVKADREALQAQNQKLHAEIMALKSR 328
            GEKKRRL++EQV+ LE++FE+ NKLEPERK +LAR LGLQPRQVA+WFQNRRARWKTKQLE+DY  L+  Y++++ D +AL+     L AEI  LK++
Sbjct:   49 GEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAK 146          
The following BLAST results are available for this feature:
BLAST of GO241389 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
HOX16_ORYSI6.710e-3255.38Homeobox-leucine zipper protein HOX16 OS=Oryza sat... [more]
HAT5_ARATH8.764e-3258.68Homeobox-leucine zipper protein HAT5 OS=Arabidopsi... [more]
ATB16_ARATH1.145e-3158.68Homeobox-leucine zipper protein ATHB-16 OS=Arabido... [more]
HOX20_ORYSJ1.495e-3163.73Homeobox-leucine zipper protein HOX20 OS=Oryza sat... [more]
HOX20_ORYSI1.495e-3163.73Homeobox-leucine zipper protein HOX20 OS=Oryza sat... [more]
ATHB6_ARATH1.495e-3156.91Homeobox-leucine zipper protein ATHB-6 OS=Arabidop... [more]
HOX5_ORYSJ1.266e-3051.91Homeobox-leucine zipper protein HOX5 OS=Oryza sati... [more]
HOX5_ORYSI1.266e-3051.91Homeobox-leucine zipper protein HOX5 OS=Oryza sati... [more]
HOX4_ORYSJ2.159e-3063.27Homeobox-leucine zipper protein HOX4 OS=Oryza sati... [more]
HOX4_ORYSI2.159e-3063.27Homeobox-leucine zipper protein HOX4 OS=Oryza sati... [more]

Pages

back to top
Libraries
Library NameType
Cara cara navel orange fruit cDNA librarycdna_library
Properties
Property NameValue
Genbank description37 Cara cara navel orange fruit cDNA library Citrus sinensis cDNA clone 119 5, mRNA sequence.