DT214489
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB22_PINSY (Chlorophyll a-b binding protein type 2 member 2 (Fragment) OS=Pinus sylvestris PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 7.253e-11 Identity = 35/64 (54.69%), Postives = 40/64 (62.50%), Query Frame = -1 Query: 138 YPGGIFNPLNFAPTDEAKE----KELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHN 317 YPG F+PL A EAK KE+ NGRLAM + GF VQ VTGKGP ENL H++DP N Sbjct: 74 YPGDAFDPLGLADDPEAKAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVAN 137
BLAST of DT214489 vs. ExPASy Swiss-Prot
Match: CB21_RAPSA (Chlorophyll a-b binding of LHCII type 1 protein (Fragment) OS=Raphanus sativus PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 9.473e-11 Identity = 35/64 (54.69%), Postives = 41/64 (64.06%), Query Frame = -1 Query: 138 YPGGIFNPLNFAPTDEA----KEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHN 317 YPGG F+PL EA K KE+ NGRLAM + GF VQ VTGKGP ENL H++DP +N Sbjct: 48 YPGGSFDPLASLTDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNN 111 The following BLAST results are available for this feature:
BLAST of DT214489 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DT214489 ID=DT214489; Name=DT214489; organism=Citrus sinensis; type=EST; length=884bpback to top |