CX287277

Overview
NameCX287277
Unique NameCX287277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length546
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9879 contig Ccv1_Contig9879:16..561. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_SILPR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Silene pratensis GN=RBCS PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.960e-67
Identity = 120/172 (69.77%), Postives = 145/172 (84.30%), Query Frame = 1
Query:   31 SSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            +S++S+  V TA+ A  AQA+MVAPF+GLKS+SAFP ++K+N DITS+A+NGGRV CM+VWPP  LKKFETLSYLP LS+E+LLKEI+YLL  GW+PCLEFE+    VYRE++ SPGYYDGRYWTMWKLPM+GCTDA+QV  EV E +  YP + VRIIGFDNKRQVQCISF
Sbjct:    2 ASLMSNAAVVTASTA--AQANMVAPFSGLKSTSAFPVSRKSNVDITSLATNGGRVNCMQVWPPRNLKKFETLSYLPTLSEESLLKEINYLLIKGWVPCLEFEVGPAHVYRENNKSPGYYDGRYWTMWKLPMFGCTDASQVAAEVVECKNAYPDAHVRIIGFDNKRQVQCISF 171          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS2_FRIAG (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Fritillaria agrestis GN=RBCS2 PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.960e-67
Identity = 120/174 (68.97%), Postives = 145/174 (83.33%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASS    ++VATA   + AQASMVAPF GLKS+SAFP T+KT   ++++ SNGGRVQCMKVWP  GLKKFETLSYLP LS E+LLK+I YL+R+GW+PCLEF LE G+V R+++ SPGYYDGRYWTMWKLPM+GCTDA QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF
Sbjct:    1 MASSATMLSSVATAACVAPAQASMVAPFVGLKSASAFPVTQKTVTGLSTLPSNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPCLEFSLE-GFVSRDNNKSPGYYDGRYWTMWKLPMFGCTDAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSF 173          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS4_LEMGI (Ribulose bisphosphate carboxylase small chain SSU40B, chloroplastic OS=Lemna gibba GN=SSU40B PE=3 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 3.866e-67
Identity = 122/174 (70.11%), Postives = 143/174 (82.18%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSM++ST  A A RA  AQ +MV PF   +SS  FPAT+K NND++++ SNGGRV CM+VWPP GLKKFETLSYLPPLS E L KE+ YLLR+ W+PC+EF  E G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF
Sbjct:    1 MASSMMASTAAAVA-RAGPAQTNMV-PFNACRSSVPFPATRKANNDLSTLPSNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISF 171          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS5_FRIAG (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Fritillaria agrestis GN=RBCS5 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 5.049e-67
Identity = 120/174 (68.97%), Postives = 145/174 (83.33%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASS    ++VATA  A+ AQASMVAPF GLKS+SAFP T+KT   ++++ SNGGRVQCMKVWP  GLKKFETLSYLP LS E+LLK+I YL+R+GW+PCLEF LE G+V R+++ SPGYYDGRYWTMWKLPM+GCT A QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF
Sbjct:    1 MASSATMLSSVATAACAAPAQASMVAPFVGLKSASAFPVTQKTATGLSTLPSNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPCLEFSLE-GFVSRDNNKSPGYYDGRYWTMWKLPMFGCTGAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSF 173          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_FRIAG (Ribulose bisphosphate carboxylase small chain 1/4, chloroplastic OS=Fritillaria agrestis GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 252.677 bits (644), Expect = 8.612e-67
Identity = 119/174 (68.39%), Postives = 145/174 (83.33%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MA+S    ++VATA  A+ AQASMVAPF GLKS+SAFP T+K    ++++ SNGGRVQCMKVWP  GLKKFETLSYLP LS E+LLK+I YL+R+GW+PCLEF LE G+V R+++ SPGYYDGRYWTMWKLPM+GCTDA QV+KE  E +KEYP +F+R+IGFDN RQVQC+SF
Sbjct:    1 MAASSTMLSSVATAACAAPAQASMVAPFVGLKSTSAFPVTQKPATGLSTLPSNGGRVQCMKVWPIVGLKKFETLSYLPTLSVESLLKQIEYLIRNGWVPCLEFSLE-GFVSRDNNKSPGYYDGRYWTMWKLPMFGCTDAAQVVKEAAECKKEYPAAFIRVIGFDNVRQVQCVSF 173          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS3_LEMGI (Ribulose bisphosphate carboxylase small chain SSU40A, chloroplastic OS=Lemna gibba GN=SSU40A PE=3 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 1.469e-66
Identity = 121/174 (69.54%), Postives = 143/174 (82.18%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSM++ST  A A RA  AQ+SMV PF   +SS  FPAT+K NN+++++  NGGRV CM+VWPP GLKKFETLSYLPPLS E L KE+ YLLR+ W+PC+EF  E G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF
Sbjct:    1 MASSMMASTAAAVA-RAGPAQSSMV-PFNACRSSVPFPATRKANNNLSTLPGNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENHASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISF 171          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS7_FLAPR (Ribulose bisphosphate carboxylase small chain 7, chloroplastic OS=Flaveria pringlei GN=RBCS7 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 7.291e-66
Identity = 114/161 (70.81%), Postives = 139/161 (86.34%), Query Frame = 1
Query:   64 ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A  A++AQA+MVAPFTGLKS++AFP TKK N D +++ASNGGRVQCMKVWPP G K++ETLSYLP L++  L KE+ YLLR+ W+PCLEFELE G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF
Sbjct:    6 ATVATVAQANMVAPFTGLKSNAAFPVTKKVN-DFSTLASNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISF 165          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS3_FLAPR (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Flaveria pringlei GN=RBCS3 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.624e-65
Identity = 113/161 (70.19%), Postives = 138/161 (85.71%), Query Frame = 1
Query:   64 ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A  A++AQA+MVAPFTGLKS++AFP TKK N D +++ SNGGRVQCMKVWPP G K++ETLSYLP L++  L KE+ YLLR+ W+PCLEFELE G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF
Sbjct:    6 ATVATVAQANMVAPFTGLKSNAAFPVTKKVN-DFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTESQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISF 165          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_FLAPR (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Flaveria pringlei GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.121e-65
Identity = 113/161 (70.19%), Postives = 138/161 (85.71%), Query Frame = 1
Query:   64 ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A  A++AQA+MVAPFTGLK+++AFP TKK N D +++ SNGGRVQCMKVWPP G KK+ETLSYLP L++  L KE+ YLLR+ W+PCLEFELE G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF
Sbjct:    6 ATVATVAQANMVAPFTGLKANAAFPVTKKVN-DFSTLPSNGGRVQCMKVWPPLGKKKYETLSYLPDLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISF 165          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS5_FLAPR (Ribulose bisphosphate carboxylase small chain 5, chloroplastic OS=Flaveria pringlei GN=RBCS5 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 2.770e-65
Identity = 113/161 (70.19%), Postives = 138/161 (85.71%), Query Frame = 1
Query:   64 ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A  A++AQA+MVAPFTGLKS++AFP TKK N D +++ SNGGRVQCMKVWPP G K++ETLSYLP L++  L KE+ YLLR+ W+PCLEFELE G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF
Sbjct:    6 ATVATVAQANMVAPFTGLKSNAAFPVTKKVN-DFSTLPSNGGRVQCMKVWPPLGKKRYETLSYLPNLTEVQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISF 165          
The following BLAST results are available for this feature:
BLAST of CX287277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
RBS_SILPR2.960e-6769.77Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_FRIAG2.960e-6768.97Ribulose bisphosphate carboxylase small chain 2, c... [more]
RBS4_LEMGI3.866e-6770.11Ribulose bisphosphate carboxylase small chain SSU4... [more]
RBS5_FRIAG5.049e-6768.97Ribulose bisphosphate carboxylase small chain 5, c... [more]
RBS1_FRIAG8.612e-6768.39Ribulose bisphosphate carboxylase small chain 1/4,... [more]
RBS3_LEMGI1.469e-6669.54Ribulose bisphosphate carboxylase small chain SSU4... [more]
RBS7_FLAPR7.291e-6670.81Ribulose bisphosphate carboxylase small chain 7, c... [more]
RBS3_FLAPR1.624e-6570.19Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS1_FLAPR2.121e-6570.19Ribulose bisphosphate carboxylase small chain 1, c... [more]
RBS5_FLAPR2.770e-6570.19Ribulose bisphosphate carboxylase small chain 5, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006G06SK Veg1 Citrus clementina cDNA clone C01006G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287277 ID=CX287277|Name=CX287277|organism=Citrus clementina|type=EST|length=546bp
AGCTAGAAGAAGGAGCAAGTACCAATGGCTTCCTCAATGATCTCATCGAC
CACCGTTGCCACCGCGAACCGCGCCAGCCTTGCTCAGGCCAGCATGGTCG
CCCCCTTCACCGGCCTCAAGTCTTCTTCTGCTTTCCCAGCAACCAAGAAG
ACCAACAATGACATTACTTCCATTGCAAGCAACGGCGGAAGAGTCCAATG
CATGAAGGTGTGGCCACCAACTGGCTTGAAGAAGTTCGAGACTCTCTCAT
ACCTCCCGCCACTGTCCGATGAAGCTTTGCTCAAGGAAATCAGTTACCTT
CTCCGCTCCGGCTGGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATG
GGTGTACCGTGAGCACCACAGCTCACCAGGATACTACGATGGACGCTACT
GGACAATGTGGAAGCTGCCCATGTATGGGTGCACAGATGCAACCCAGGTT
TTGAAGGAGGTTGGGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCG
AATTATCGGATTTGACAACAAGCGTCAAGTGCAGTGCATCAGTTTC
back to top