CX287277

Overview
NameCX287277
Unique NameCX287277
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length546
Libraries
Library NameType
Veg1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9879 contig Ccv1_Contig9879:16..561. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS6_FLAPR (Ribulose bisphosphate carboxylase small chain 6, chloroplastic OS=Flaveria pringlei GN=RBCS6 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.053e-64
Identity = 112/161 (69.57%), Postives = 137/161 (85.09%), Query Frame = 1
Query:   64 ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A  A++AQA+MVAPFTGLK+++AFP TKK N D +++ SNGGRVQCMKVWPP G KK+ TLSYLP L++  L KE+ YLLR+ W+PCLEFELE G+VYRE+  SPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQCISF
Sbjct:    6 ATVAAVAQANMVAPFTGLKANAAFPVTKKVN-DFSTLPSNGGRVQCMKVWPPLGKKKYXTLSYLPNLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENARSPGYYDGRYWTMWKLPMFGCTDSVQVMKELQECKKEYPQAWIRIIGFDNVRQVQCISF 165          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_FLATR (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Flaveria trinervia GN=RBCS PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.345e-64
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 1
Query:   64 ANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            A  A++ Q +MVAPFTGLK+++AFP TKK N   +++ SNGGRVQCMKVWPP G KK+ETLSYLP L++  L KE+ YLLR+ W+PCLEFELE G+VYRE+ SSPGYYDGRYWTMWKLPM+GCTD+ QV+KE+ E +KEYP +++RIIGFDN RQVQC+SF
Sbjct:    6 ATVAAVPQTNMVAPFTGLKANAAFPVTKKVNG-FSTLPSNGGRVQCMKVWPPVGKKKYETLSYLPELTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENASSPGYYDGRYWTMWKLPMFGCTDSAQVMKELQECKKEYPQAWIRIIGFDNVRQVQCVSF 165          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_LEMGI (Ribulose bisphosphate carboxylase small chain SSU1, chloroplastic OS=Lemna gibba GN=SSU1 PE=2 SV=2)

HSP 1 Score: 244.588 bits (623), Expect = 2.345e-64
Identity = 115/170 (67.65%), Postives = 138/170 (81.18%), Query Frame = 1
Query:   37 MISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            M+S+  VA   R   AQ +MV  F G +SS AFPAT+K NND++++ S+GGRV CM+VWPP GLKKFETLSYLPPLS E L KE+ YLLR+ W+PC+EF  E G+VYRE+++SPGYYDGRYWTMWKLPM+GCTDA+QV+ EV E +K YP  FVRIIGFDNKRQVQCISF
Sbjct:    2 MVSTAAVA---RVRPAQTNMVGAFNGCRSSVAFPATRKANNDLSTLPSSGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVDYLLRNDWVPCIEFSKE-GFVYRENNASPGYYDGRYWTMWKLPMFGCTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISF 167          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_ZANAE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Zantedeschia aethiopica GN=RBCS PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 8.341e-62
Identity = 116/174 (66.67%), Postives = 139/174 (79.89%), Query Frame = 1
Query:   25 MASSMISSTTVATANRASLAQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            MASSM+ ST  A  +R S AQ++MV PF GL SS+AFP T+K   D + + SNG RV+CM+VWPP G KKFETLSYLPPL+ E L +E+ YL+R+GWIPC+EF  + G+VYRE+H+SPGYYDGRYWTMWKLPM+GCTD++QVLKEV E  K YP  F RIIGFDN RQVQCISF
Sbjct:    1 MASSMMVST--AAVSRTSPAQSNMVVPFAGLHSSAAFPVTRKFA-DSSKLPSNGLRVRCMQVWPPEGKKKFETLSYLPPLTREQLGQEVDYLIRNGWIPCIEF-CKVGFVYREYHNSPGYYDGRYWTMWKLPMFGCTDSSQVLKEVDECSKAYPDYFNRIIGFDNTRQVQCISF 170          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS_HORVU (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.573e-60
Identity = 104/155 (67.10%), Postives = 132/155 (85.16%), Query Frame = 1
Query:   82 AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            + A+ VAPF GLKS++  P ++++N    S+ SNGGR++CM+VWP  G+KKFETLSYLPPLS EALLK++ YL+RS W+PCLEF  + G+++REH++SPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VRIIGFDN RQVQC+SF
Sbjct:    8 SSATSVAPFQGLKSTAGLPVSRRSNASSASV-SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFS-KVGFIFREHNASPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSF 160          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS2_WHEAT (Ribulose bisphosphate carboxylase small chain PW9, chloroplastic OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 3.505e-60
Identity = 104/155 (67.10%), Postives = 130/155 (83.87%), Query Frame = 1
Query:   82 AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            + A+ VAPF GLKS++  P + ++ +   S  SNGGR++CM+VWP  G+KKFETLSYLPPLS EALLK++ YL+RS W+PCLEF  + G+V+REH+SSPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VR+IGFDN RQVQC+SF
Sbjct:    8 SSATTVAPFQGLKSTAGLPISCRSGSTGLSSVSNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFS-KVGFVFREHNSSPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRVIGFDNMRQVQCVSF 161          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_WHEAT (Ribulose bisphosphate carboxylase small chain PWS4.3, chloroplastic OS=Triticum aestivum PE=3 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 7.807e-60
Identity = 103/155 (66.45%), Postives = 131/155 (84.52%), Query Frame = 1
Query:   82 AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            + A+ VAPF GLKS++  P ++++   + S+ SNGGR++CM+VWP  G+KKFETLSYLPPLS EAL K++ YL+RS W+PCLEF  + G+V+REH+SSPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VR+IGFDN RQVQC+SF
Sbjct:    8 SSATTVAPFQGLKSTAGLPVSRRSRGSLGSV-SNGGRIRCMQVWPIEGIKKFETLSYLPPLSTEALSKQVDYLIRSKWVPCLEFS-KVGFVFREHNSSPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRVIGFDNLRQVQCVSF 160          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_ORYSJ (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Oryza sativa subsp. japonica GN=RBCS PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 2.512e-58
Identity = 104/155 (67.10%), Postives = 125/155 (80.65%), Query Frame = 1
Query:   82 AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            + A+ VAPF GLKS++  P  +++ N      SNGGR++CM+VWP  G+KKFETLSYLPPL+ E LLK+I YLLRS W+PCLEF  + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVLKE+ E +K YP +FVRIIGFDN RQVQ ISF
Sbjct:    8 SSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFS-KVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISF 161          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS1_ORYSI (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Oryza sativa subsp. indica GN=RBCS PE=2 SV=2)

HSP 1 Score: 224.557 bits (571), Expect = 2.512e-58
Identity = 104/155 (67.10%), Postives = 125/155 (80.65%), Query Frame = 1
Query:   82 AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            + A+ VAPF GLKS++  P  +++ N      SNGGR++CM+VWP  G+KKFETLSYLPPL+ E LLK+I YLLRS W+PCLEF  + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVLKE+ E +K YP +FVRIIGFDN RQVQ ISF
Sbjct:    8 SSATTVAPFQGLKSTAGMPVARRSGNSSFGNVSNGGRIRCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFS-KVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISF 161          
BLAST of CX287277 vs. ExPASy Swiss-Prot
Match: RBS2_ORYSJ (Ribulose bisphosphate carboxylase small chain A, chloroplastic OS=Oryza sativa subsp. japonica GN=RBCS-A PE=2 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 3.280e-58
Identity = 104/155 (67.10%), Postives = 126/155 (81.29%), Query Frame = 1
Query:   82 AQASMVAPFTGLKSSSAFPATKKTNNDITSIASNGGRVQCMKVWPPTGLKKFETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISF 546
            + A+ VAPF GLKS++  P ++++ N      SNGGR++CM+VWP  G+KKFETLSYLPPL+ E LLK+I YLLRS W+PCLEF  + G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVLKE+ E +K YP +FVRIIGFDN RQVQ ISF
Sbjct:    8 SSATSVAPFQGLKSTAGLPVSRRSTNSGFGNVSNGGRIKCMQVWPIEGIKKFETLSYLPPLTVEDLLKQIEYLLRSKWVPCLEFS-KVGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDATQVLKELEEAKKAYPDAFVRIIGFDNVRQVQLISF 161          
The following BLAST results are available for this feature:
BLAST of CX287277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 127
Match NameE-valueIdentityDescription
RBS6_FLAPR1.053e-6469.57Ribulose bisphosphate carboxylase small chain 6, c... [more]
RBS_FLATR2.345e-6468.32Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_LEMGI2.345e-6467.65Ribulose bisphosphate carboxylase small chain SSU1... [more]
RBS_ZANAE8.341e-6266.67Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HORVU1.573e-6067.10Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_WHEAT3.505e-6067.10Ribulose bisphosphate carboxylase small chain PW9,... [more]
RBS1_WHEAT7.807e-6066.45Ribulose bisphosphate carboxylase small chain PWS4... [more]
RBS1_ORYSJ2.512e-5867.10Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS1_ORYSI2.512e-5867.10Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_ORYSJ3.280e-5867.10Ribulose bisphosphate carboxylase small chain A, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC01006G06SK Veg1 Citrus clementina cDNA clone C01006G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX287277 ID=CX287277|Name=CX287277|organism=Citrus clementina|type=EST|length=546bp
AGCTAGAAGAAGGAGCAAGTACCAATGGCTTCCTCAATGATCTCATCGAC
CACCGTTGCCACCGCGAACCGCGCCAGCCTTGCTCAGGCCAGCATGGTCG
CCCCCTTCACCGGCCTCAAGTCTTCTTCTGCTTTCCCAGCAACCAAGAAG
ACCAACAATGACATTACTTCCATTGCAAGCAACGGCGGAAGAGTCCAATG
CATGAAGGTGTGGCCACCAACTGGCTTGAAGAAGTTCGAGACTCTCTCAT
ACCTCCCGCCACTGTCCGATGAAGCTTTGCTCAAGGAAATCAGTTACCTT
CTCCGCTCCGGCTGGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATG
GGTGTACCGTGAGCACCACAGCTCACCAGGATACTACGATGGACGCTACT
GGACAATGTGGAAGCTGCCCATGTATGGGTGCACAGATGCAACCCAGGTT
TTGAAGGAGGTTGGGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCG
AATTATCGGATTTGACAACAAGCGTCAAGTGCAGTGCATCAGTTTC
back to top