CX287332
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STAA8 (Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 4.575e-16 Identity = 39/76 (51.32%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTDA + S V +SG LV+FWA WCGPC+MI P+++EL+ Y GK K++ DE+PS A +Y + SIPT+++FK Sbjct: 6 VTDADFDSKV-ESGVQ-LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STAA3 (Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 4.575e-16 Identity = 39/76 (51.32%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTDA + S V +SG LV+FWA WCGPC+MI P+++EL+ Y GK K++ DE+PS A +Y + SIPT+++FK Sbjct: 6 VTDADFDSKV-ESGVQ-LVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_BUCBP (Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae GN=trxA PE=3 SV=1) HSP 1 Score: 83.1889 bits (204), Expect = 4.575e-16 Identity = 32/76 (42.11%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 +TD ++ +L+S VLV+FWA WC PC+++ PI+++++K+Y KL K+N D++P+ A +Y IR IP +++FK Sbjct: 8 LTDGIFKQYILESKKAVLVDFWAEWCNPCKILAPILEDIAKEYEHKLIVTKINIDKNPNTAPKYSIRGIPALLLFK 83
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_RHORU (Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.019e-15 Identity = 35/76 (46.05%), Postives = 51/76 (67.11%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 V+DA+++ VL + P V+FWA WCGPCR P ++EL+ K+ K+N DE+P ++YG+R IPT+MIFK Sbjct: 4 VSDASFEEDVLKADGPNXVDFWAEWCGPCRQXAPALEELATALGDKVTVAKINIDENPQTPSKYGVRGIPTLMIFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_BUCAI (Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=trxA PE=3 SV=1) HSP 1 Score: 82.0333 bits (201), Expect = 1.019e-15 Identity = 35/75 (46.67%), Postives = 55/75 (73.33%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIF 402 +TD ++ VL+S S LV+FWA WC PC+++ PI++E+SK+Y K+ K+N +E+P+ A Y IRSIPT+++F Sbjct: 7 LTDQNFEEQVLNSKSFFLVDFWAQWCNPCKILAPILEEISKEYSNKVIVGKLNIEENPNTAPVYSIRSIPTLLLF 81
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STRCL (Thioredoxin OS=Streptomyces clavuligerus GN=trxA PE=1 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 1.738e-15 Identity = 34/76 (44.74%), Postives = 57/76 (75.00%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTD T+++ VL S PVLV+FWA WCGPCR I P ++ ++ ++ G+++ K+N D++P+ A +YG+ SIPT+ +++ Sbjct: 8 VTDDTFEADVLKSEKPVLVDFWAEWCGPCRQIAPSLEAIT-EHGGQIEIVKLNIDQNPATAAKYGVMSIPTLNVYQ 82
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STAES (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxA PE=3 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 2.270e-15 Identity = 37/76 (48.68%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTD+ + S + +SG LV+FWA WCGPC+MI P+++EL+ Y GK K++ DE+PS A +Y + SIPT+++FK Sbjct: 6 VTDSDFDSKI-ESGVK-LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_STAEQ (Thioredoxin OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxA PE=3 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 2.270e-15 Identity = 37/76 (48.68%), Postives = 55/76 (72.37%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTD+ + S + +SG LV+FWA WCGPC+MI P+++EL+ Y GK K++ DE+PS A +Y + SIPT+++FK Sbjct: 6 VTDSDFDSKI-ESGVK-LVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKYEVMSIPTLIVFK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_BACSU (Thioredoxin OS=Bacillus subtilis GN=trxA PE=1 SV=3) HSP 1 Score: 80.8777 bits (198), Expect = 2.270e-15 Identity = 36/78 (46.15%), Postives = 53/78 (67.95%), Query Frame = 1 Query: 175 AVTDATWQSLVLD-SGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 A+ AT QS + S VL +FWAPWCGPC+MI P+++EL ++ KLK K++ DE+ A +YG+ SIPT+++ K Sbjct: 2 AIVKATDQSFSAETSEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLK 79
BLAST of CX287332 vs. ExPASy Swiss-Prot
Match: THIO_MYCTU (Thioredoxin OS=Mycobacterium tuberculosis GN=trxA PE=1 SV=2) HSP 1 Score: 80.1073 bits (196), Expect = 3.873e-15 Identity = 33/76 (43.42%), Postives = 53/76 (69.74%), Query Frame = 1 Query: 178 VTDATWQSLVLDSGSPVLVEFWAPWCGPCRMIHPIIDELSKQYVGKLKCYKVNTDESPSIATRYGIRSIPTVMIFK 405 VTDA++ + VL S PVLV+FWA WCGPC+M+ P+++E++ + L K++ D +P A + + SIPT+++FK Sbjct: 12 VTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFK 87 The following BLAST results are available for this feature:
BLAST of CX287332 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 91
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287332 ID=CX287332; Name=CX287332; organism=Citrus clementina; type=EST; length=406bpback to top |