CX293877

Overview
NameCX293877
Unique NameCX293877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig872 contig Ccv1_Contig872:40..548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP15_SOYBN (17.6 kDa class I heat shock protein OS=Glycine max GN=HSP17.6-L PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.148e-46
Identity = 96/159 (60.38%), Postives = 110/159 (69.18%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIPSIFGG R+NVFDP SLD+WDPF  F      + P+S+   E S F N R+DWKET +AHV KAD+PGL+           R+LQISGER+ E E+KND WHRV RSSGKF+RRFRLP+NAKVEQVKA MENGVLTVT             IEIS
Sbjct:    1 MSLIPSIFGGPRSNVFDPFSLDMWDPFKDF------HVPTSSVSAENSAFVNTRVDWKETQEAHVLKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVDRSSGKFMRRFRLPENAKVEQVKACMENGVLTVTIPKEEVKKSDVKPIEIS 153          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP12_DAUCA (18.0 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.148e-46
Identity = 92/158 (58.23%), Postives = 112/158 (70.89%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGF-LSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MS+IPS FG RR+NV +P SLD+WDPF  + L ++   +    +ET+ FAN  IDWKET QAHVFKADLPGL+          G++LQISGER+KE EEKN+KWHRV+ SSGKFLRRFRLP+NA V++VKA MENGVLTVT            +I IS
Sbjct:    1 MSIIPSFFGSRRSNVLNPFSLDIWDPFQDYPLITSSGTSSEFGKETAAFANTHIDWKETPQAHVFKADLPGLKKEEVKVEVEEGKVLQISGERNKEKEEKNNKWHRVEFSSGKFLRRFRLPENANVDEVKAGMENGVLTVTVPKVEMKKPEVKSIHIS 158          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS17A_ORYSJ (17.9 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.9A PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 2.040e-45
Identity = 97/156 (62.18%), Postives = 111/156 (71.15%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFL-----SSALTNAPSSAR----ETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RR+NVFDP SLD+WDPFDGF      SS+ +  PS  R    ET+ FA ARIDWKET +AHVFKAD+PGL+          G ILQISGER+KE EEK D+WHRV+RSSGKFLRRFRLPDNAK EQ+KASMENGVLTVT            +I+IS
Sbjct:    5 RRSNVFDPFSLDLWDPFDGFPFGSGGSSSGSIFPSFPRGASSETAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVDDGNILQISGERNKEQEEKTDQWHRVERSSGKFLRRFRLPDNAKPEQIKASMENGVLTVTVPKEEAKKPDVKSIQIS 160          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_HELAN (17.6 kDa class I heat shock protein OS=Helianthus annuus GN=HSP17.6 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 2.665e-45
Identity = 86/139 (61.87%), Postives = 105/139 (75.54%), Query Frame = 2
Query:   38 MSLIPSIFGGRRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTV 454
            MS+IPS F  +R+N+FDP SLD WDPF G +S+        ARET+   NARIDWKET +AHV KADLPG++          GR+LQISGER +E EEK+D WHRV+RSSGKF+RRFRLP+NAK+++VKA MENGVLTV
Sbjct:    1 MSIIPSFFTSKRSNIFDPFSLDTWDPFQGIIST------EPARETAAIVNARIDWKETPEAHVLKADLPGMKKEEVKVEVEDGRVLQISGERCREQEEKDDTWHRVERSSGKFIRRFRLPENAKMDEVKAMMENGVLTV 133          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP12_SOLPE (17.6 kDa class I heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.480e-45
Identity = 97/158 (61.39%), Postives = 113/158 (71.52%), Query Frame = 2
Query:   38 MSLIPSIFGGRR-TNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            MSLIP IFG RR T+VFDP S+DV+DPF       L    S++ ETS FAN RIDWKET +AHVFKADLPGL+           R+LQISGER+ E E+KND WHRV+RSSGKF+RRFRLP+NAK++QVKASMENGVLTVT            +IEIS
Sbjct:    1 MSLIPRIFGDRRSTSVFDPFSIDVFDPF-----KELGFTVSNSGETSAFANTRIDWKETPEAHVFKADLPGLKKEEVKVEVEEDRVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKMDQVKASMENGVLTVTVPKEEVNNPDVKSIEIS 153          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS16B_ORYSJ (16.9 kDa class I heat shock protein 2 OS=Oryza sativa subsp. japonica GN=HSP16.9B PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.322e-44
Identity = 89/147 (60.54%), Postives = 107/147 (72.79%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RR+NVFDP SLD+WDPFD    S +    +S  +T+ FANARIDWKET ++HVFKADLPG++          G +L ISG+RSKE E+KNDKWHRV+RSSG+F+RRFRLP+NAKV+QVKA MENGVLTVT            AIEIS
Sbjct:    5 RRSNVFDPFSLDLWDPFDSVFRSVVP--ATSDNDTAAFANARIDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSSGQFMRRFRLPENAKVDQVKAGMENGVLTVTVPKAEVKKPEVKAIEIS 149          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS181_ORYSJ (18.1 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.727e-44
Identity = 89/139 (64.03%), Postives = 103/139 (74.10%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFLSSALTNAPSS---------ARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            RR+NVFDP SLD+WDPFDGF   + + +  S         + ET+ FA ARIDWKET +AHVFKAD+PGL+          G +LQISGERSKE EEK DKWHRV+RSSGKFLRRFRLP+N K EQ+KASMENGVLTVT
Sbjct:    5 RRSNVFDPFSLDLWDPFDGFPFGSGSRSSGSIFPSFPRGTSSETAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVEDGNVLQISGERSKEQEEKTDKWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVT 143          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP11_CHERU (18.3 kDa class I heat shock protein OS=Chenopodium rubrum GN=HSP18 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.946e-44
Identity = 92/145 (63.45%), Postives = 113/145 (77.93%), Query Frame = 2
Query:   38 MSLIPSIF--GGRRTNVFDPVSLD-VWDPFDGFLSSALTNAPSS--ARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            MSLIP+ +   GRR+N+FDP SLD +WDPF G L S L+  P S  A ET+ FANARIDWKET +AHVFKADLPG++          G +L+ISG+R++E EEKND WHRV+RSSG+F+R+FRLP+NAKV+QVKA MENGVLTVT
Sbjct:    1 MSLIPNNWFNTGRRSNIFDPFSLDEIWDPFFG-LPSTLSTVPRSETAAETAAFANARIDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLRISGQRAREKEEKNDTWHRVERSSGQFMRKFRLPENAKVDQVKAGMENGVLTVT 144          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS16A_ORYSJ (16.9 kDa class I heat shock protein 1 OS=Oryza sativa subsp. japonica GN=HSP16.9A PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.946e-44
Identity = 88/147 (59.86%), Postives = 107/147 (72.79%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            RR+NVFDP SLD+WDPFD    S +    +S  +T+ FANARIDWKET ++HVFKADLPG++          G +L ISG+RSKE E+KNDKWHRV+RSSG+F+RRFRLP+NAKV+QVKA +ENGVLTVT            AIEIS
Sbjct:    5 RRSNVFDPFSLDLWDPFDSVFRSVVP--ATSDNDTAAFANARIDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSSGQFMRRFRLPENAKVDQVKAGLENGVLTVTVPKAEVKKPEVKAIEIS 149          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS174_ORYSJ (17.4 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.4 PE=2 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 8.572e-44
Identity = 86/132 (65.15%), Postives = 101/132 (76.52%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFLSSALTNA--PSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            RR+NVFDP SLD+WDPFDGF   + + +  P +  + + FA ARIDWKET +AHVFKAD+PGL+          G +LQISGER KE EEK DKWHRV+RSSGKFLRRFRLP+N K EQ+KASMENGVLTVT
Sbjct:    5 RRSNVFDPFSLDLWDPFDGFPFGSGSGSLFPRANSDAAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVEDGNVLQISGERIKEQEEKTDKWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVT 136          
The following BLAST results are available for this feature:
BLAST of CX293877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP15_SOYBN3.148e-4660.3817.6 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_DAUCA3.148e-4658.2318.0 kDa class I heat shock protein OS=Daucus caro... [more]
HS17A_ORYSJ2.040e-4562.1817.9 kDa class I heat shock protein OS=Oryza sativ... [more]
HSP11_HELAN2.665e-4561.8717.6 kDa class I heat shock protein OS=Helianthus ... [more]
HSP12_SOLPE3.480e-4561.3917.6 kDa class I heat shock protein OS=Solanum per... [more]
HS16B_ORYSJ1.322e-4460.5416.9 kDa class I heat shock protein 2 OS=Oryza sat... [more]
HS181_ORYSJ1.727e-4464.0318.1 kDa class I heat shock protein OS=Oryza sativ... [more]
HSP11_CHERU2.946e-4463.4518.3 kDa class I heat shock protein OS=Chenopodium... [more]
HS16A_ORYSJ2.946e-4459.8616.9 kDa class I heat shock protein 1 OS=Oryza sat... [more]
HS174_ORYSJ8.572e-4465.1517.4 kDa class I heat shock protein OS=Oryza sativ... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A02SK FlavRip1 Citrus clementina cDNA clone C05002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293877 ID=CX293877|Name=CX293877|organism=Citrus clementina|type=EST|length=509bp
GTTGTTGAGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTC
CAAGCATCTTCGGGGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTA
GATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGC
GCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACT
GGAAAGAGACTGCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTG
AGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGAT
AAGCGGCGAGAGGAGCAAGGAGCATGAAGAGAAGAATGACAAGTGGCATC
GCGTCCAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGAC
AATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCAC
AGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTG
AGATCTCTG
back to top