CX293877

Overview
NameCX293877
Unique NameCX293877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig872 contig Ccv1_Contig872:40..548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS166_ORYSJ (16.6 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP16.6 PE=2 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.266e-28
Identity = 73/150 (48.67%), Postives = 87/150 (58.00%), Query Frame = 2
Query:   68 RRTNVFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEE--KND-KWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            R  NV DP+S+D W   D F +       S A       N R+DWKET  AHVF ADLPG+R          G +L ISGER++E +   KND +WH V+RSSGKF RRFRLP  A+V+QV ASM+NGVLTVT            AI IS
Sbjct:    5 RSGNVLDPMSVDFWADADPFGA-----VRSLAERCPVLTNVRVDWKETPTAHVFTADLPGVRKDQAKVEVEDGGVLVISGERAREEDVDGKNDERWHHVERSSGKFQRRFRLPRGARVDQVSASMDNGVLTVTVPKEETKKPQLKAIPIS 149          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS189_ORYSJ (18.9 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.9 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.121e-26
Identity = 60/134 (44.78%), Postives = 87/134 (64.93%), Query Frame = 2
Query:   62 GGRRTNVFDPVSLDVWDPF-DGFLSSALTNAPSSARETSQF-ANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            GG      +PVS+D+ +PF D    +A   APS+A   +   + A +DWKETA AHVF AD+PG+R           ++L+ISG+R++  EEK ++WHRV+RSS +F+R  RLP NA  + V A+++NGVLT+T
Sbjct:   26 GGGGGGEIEPVSVDIMEPFMDAISLTAFAAAPSAAAAAAGVPSTASMDWKETAAAHVFMADMPGVRREEVRVEVEEEKVLRISGQRARAAEEKGERWHRVERSSERFVRTVRLPPNANTDGVHAALDNGVLTIT 159          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP41_SOYBN (22.0 kDa class IV heat shock protein OS=Glycine max GN=HSP22.0 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 9.853e-24
Identity = 49/90 (54.44%), Postives = 63/90 (70.00%), Query Frame = 2
Query:  188 ARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            AR+DWKET + HV   D+PGL+           R+L++SGER KE E+K D WHRV+RS GKF R+FRLP N  ++ VKA +ENGVLT+T
Sbjct:   67 ARVDWKETPEGHVIMLDVPGLKREEIKVEVEENRVLRVSGERKKEEEKKGDHWHRVERSYGKFWRQFRLPQNVDLDSVKAKLENGVLTLT 156          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP41_PEA (22.7 kDa class IV heat shock protein OS=Pisum sativum GN=HSP22.7 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 9.853e-24
Identity = 48/92 (52.17%), Postives = 65/92 (70.65%), Query Frame = 2
Query:  182 ANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            ++AR+DWKET + HV   D+PGL+           R+L++SGER KE ++K D WHRV+RS GKF R+F+LP N  ++ VKA MENGVLT+T
Sbjct:   73 SHARVDWKETPEGHVIMVDVPGLKKDDIKIEVEENRVLRVSGERKKEEDKKGDHWHRVERSYGKFWRQFKLPQNVDLDSVKAKMENGVLTLT 164          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP22_ARATH (22.0 kDa heat shock protein OS=Arabidopsis thaliana GN=HSP22.0 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.195e-23
Identity = 50/98 (51.02%), Postives = 68/98 (69.39%), Query Frame = 2
Query:  164 RETS-QFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTV 454
            R+TS   + AR+DWKETA+ H    D+PGL+            +L++SGER +E E+K D+WHRV+RS GKF R+F+LPDN  +E VKA +ENGVLT+
Sbjct:   62 RDTSVALSPARVDWKETAEGHEIMLDIPGLKKDEVKIEVEENGVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESVKAKLENGVLTI 159          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS17B_ORYSJ (17.9 kDa heat shock protein 2 OS=Oryza sativa subsp. japonica GN=HSP17.9B PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.170e-22
Identity = 56/127 (44.09%), Postives = 81/127 (63.78%), Query Frame = 2
Query:   80 VFDPVSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLP-GLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            +FD ++ D W+PF  F ++   +A   A +TS FAN  I+ +ETA+A+VF+ADLP G++          G +L I+GERS   EEK  + H ++RS   F  RF LPD+A V+ V+ASM+ G+LTVT
Sbjct:    6 LFDTLAFDAWNPFSIFGTTVAADA-WLASDTSAFANTYIESRETAEAYVFRADLPAGVKKEEVRVEVDEGNVLVITGERSVRREEKGQRSHHIERSCATFFGRFHLPDDAVVDLVRASMDGGMLTVT 131          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP12_SOYBN (Class I heat shock protein (Fragment) OS=Glycine max GN=HSP6834-A PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.573e-21
Identity = 52/73 (71.23%), Postives = 57/73 (78.08%), Query Frame = 2
Query:  290 ILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEIS 508
            ILQISGER+ E E+KND WHRV+RSSGKF+R FRLPDNAKV+QVKASMENGVLTVT            AIEIS
Sbjct:    1 ILQISGERNVEKEDKNDTWHRVERSSGKFMRSFRLPDNAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIEIS 73          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS232_ORYSJ (23.2 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP23.2 PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 7.307e-19
Identity = 61/158 (38.61%), Postives = 87/158 (55.06%), Query Frame = 2
Query:    5 LSI*LASQFAIMSLIPSIFGG--RRTNVFDPVSLDVWDPFDGFLSSALTNAPSS--ARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEH--EEKN--DKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTV 454
            +++ LAS  A  +L+P   GG  R   V +   L   DPF       L + P      + +  + AR+DW+ET  AH    D+PG+R           R+L+ISGER +E   E+K   D WHR +RS G+F R+ RLPDNA ++ + AS++NGVLTV
Sbjct:   16 IAVVLASTAADGALLPWFGGGGARDEAVPELGLLAAADPF-----RILEHVPFGFDRDDVAMLSMARVDWRETGDAHEVVVDVPGMRKEDLRVEVEDNRVLRISGERRREETTEQKGGGDHWHREERSYGRFWRQLRLPDNADLDSIAASLDNGVLTV 168          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS219_ORYSJ (21.9 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP21.9 PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 4.010e-17
Identity = 48/111 (43.24%), Postives = 70/111 (63.06%), Query Frame = 2
Query:  149 APSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXG-RILQISGER-----SKEHEEKND--KWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            A ++A E +  A AR DWKET +AHV   D+PG+R            R+L++SGER     ++E E + D  +WHR +R++G+F RRFR+P  A V +V A +++GVLTVT
Sbjct:   59 AAAAAGEPAAVALARCDWKETPEAHVVTVDVPGVRRGDVRVEVDEASRVLRVSGERRRAGAAEEEEGERDGVRWHRAERAAGRFWRRFRMPPGADVGRVAARLDDGVLTVT 169          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS157_ARATH (15.7 kDa heat shock protein, peroxisomal OS=Arabidopsis thaliana GN=HSP15.7 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.874e-15
Identity = 41/96 (42.71%), Postives = 57/96 (59.38%), Query Frame = 2
Query:  182 ANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSS-----GKFLRRFRLPDNAKVEQVKASMENGVLTV 454
            + A IDW E+  +H+FK ++PG            G +L I GE  KE +++N  WH  +R +      +FLRR  LP+N KV+QVKA +ENGVLTV
Sbjct:   20 STALIDWMESNNSHIFKINVPGYNKEDIKVQIEEGNVLSIRGEGIKEEKKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQVKAYVENGVLTV 115          
The following BLAST results are available for this feature:
BLAST of CX293877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HS166_ORYSJ2.266e-2848.6716.6 kDa heat shock protein OS=Oryza sativa subsp.... [more]
HS189_ORYSJ2.121e-2644.7818.9 kDa heat shock protein OS=Oryza sativa subsp.... [more]
HSP41_SOYBN9.853e-2454.4422.0 kDa class IV heat shock protein OS=Glycine ma... [more]
HSP41_PEA9.853e-2452.1722.7 kDa class IV heat shock protein OS=Pisum sati... [more]
HSP22_ARATH2.195e-2351.0222.0 kDa heat shock protein OS=Arabidopsis thalian... [more]
HS17B_ORYSJ3.170e-2244.0917.9 kDa heat shock protein 2 OS=Oryza sativa subs... [more]
HSP12_SOYBN1.573e-2171.23Class I heat shock protein (Fragment) OS=Glycine m... [more]
HS232_ORYSJ7.307e-1938.6123.2 kDa heat shock protein OS=Oryza sativa subsp.... [more]
HS219_ORYSJ4.010e-1743.2421.9 kDa heat shock protein OS=Oryza sativa subsp.... [more]
HS157_ARATH2.874e-1542.7115.7 kDa heat shock protein, peroxisomal OS=Arabid... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A02SK FlavRip1 Citrus clementina cDNA clone C05002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293877 ID=CX293877|Name=CX293877|organism=Citrus clementina|type=EST|length=509bp
GTTGTTGAGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTC
CAAGCATCTTCGGGGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTA
GATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGC
GCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACT
GGAAAGAGACTGCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTG
AGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGAT
AAGCGGCGAGAGGAGCAAGGAGCATGAAGAGAAGAATGACAAGTGGCATC
GCGTCCAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGAC
AATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCAC
AGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTG
AGATCTCTG
back to top