CX293877

Overview
NameCX293877
Unique NameCX293877
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig872 contig Ccv1_Contig872:40..548. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS177_ARATH (17.7 kDa class II heat shock protein OS=Arabidopsis thaliana GN=HSP17.7 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.884e-12
Identity = 39/107 (36.45%), Postives = 62/107 (57.94%), Query Frame = 2
Query:  146 NAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKND-KWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            N PS A  R+    A    D  E   A+VF  D+PG++            +L +SG+R ++++E    K+ R++R  GKF+R+F+LPDNA +E++ A+  +GVL VT
Sbjct:   30 NNPSRAYMRDAKAMAATPADVIEHPDAYVFAVDMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMRKFQLPDNADLEKISAACNDGVLKVT 136          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP21_MAIZE (17.5 kDa class II heat shock protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 6.625e-12
Identity = 38/87 (43.68%), Postives = 54/87 (62.07%), Query Frame = 2
Query:  197 DWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            D KE   A+ F  D+PGL            R+L ISGER +E E ++ K+ R++R  GKF+R+F LPDNA ++++ A   +GVLTVT
Sbjct:   56 DVKELPGAYAFVVDMPGLGTGDIKVQVEDERVLVISGERRRE-EREDAKYLRMERRMGKFMRKFVLPDNADMDKISAVCRDGVLTVT 141          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS178_ORYSJ (17.8 kDa heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.8 PE=2 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 1.130e-11
Identity = 41/111 (36.94%), Postives = 61/111 (54.95%), Query Frame = 2
Query:  182 ANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQI--------------SGERSKEHEEKND--KWHRVQRSSGK---FLRRFRLPDNAKVEQVKASMENGVLTVT 457
            A   +DW+ET  AHVF+ DLPGL           G IL++              +G+ S E EE+ND  +WH  +R++G+    + +FRLP++A  ++  A M +GVLTVT
Sbjct:   25 ARPPMDWRETPVAHVFEMDLPGLAKDQVAVEVVDGHILRVRAGGEHEDANNAAKAGKASGEEEEENDGVRWHCRERAAGRRRAAVTQFRLPEDAAADEASARMADGVLTVT 135          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HSP16_ORYSJ (16.0 kDa heat shock protein, peroxisomal OS=Oryza sativa subsp. japonica GN=HSP16.0 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.927e-11
Identity = 42/119 (35.29%), Postives = 57/119 (47.90%), Query Frame = 2
Query:  116 FDGFLSSALTNAPSSARETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGER-----SKEHE-EKNDKWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTV 454
            F G     L   P      S  A A +DW ET  +HV + ++PGL           G +L + G        KE E EK+  WH  +R   +F R   LP   +VEQ++AS++NGVLTV
Sbjct:    6 FGGPFRRILYGRPFPPDWASASATAAMDWVETPTSHVLRINVPGLGKDDVKVQVEDGNVLTVRGAAPHAAAEKEREREKDVVWHVAERGRPEFAREVALPAEVRVEQIRASVDNGVLTV 124          
BLAST of CX293877 vs. ExPASy Swiss-Prot
Match: HS176_ARATH (17.6 kDa class II heat shock protein OS=Arabidopsis thaliana GN=HSP17.6 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 5.608e-11
Identity = 37/107 (34.58%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  146 NAPSSA--RETSQFANARIDWKETAQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEHEEKND-KWHRVQRSSGKFLRRFRLPDNAKVEQVKASMENGVLTVT 457
            N PS    R+    A    D  E   A+ F  D+PG++            +L +SGER +E++E    K+ R++R  GKF+R+F+LP+NA ++++ A   +GVL VT
Sbjct:   29 NNPSRVYMRDAKAMAATPADVIEHPNAYAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMRKFQLPENADLDKISAVCHDGVLKVT 135          
The following BLAST results are available for this feature:
BLAST of CX293877 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HS177_ARATH3.884e-1236.4517.7 kDa class II heat shock protein OS=Arabidopsi... [more]
HSP21_MAIZE6.625e-1243.6817.5 kDa class II heat shock protein OS=Zea mays P... [more]
HS178_ORYSJ1.130e-1136.9417.8 kDa heat shock protein OS=Oryza sativa subsp.... [more]
HSP16_ORYSJ1.927e-1135.2916.0 kDa heat shock protein, peroxisomal OS=Oryza ... [more]
HS176_ARATH5.608e-1134.5817.6 kDa class II heat shock protein OS=Arabidopsi... [more]

Pages

back to top
Libraries
Library NameType
FlavRip1cdna_library
Properties
Property NameValue
Genbank descriptionC05002A02SK FlavRip1 Citrus clementina cDNA clone C05002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX293877 ID=CX293877|Name=CX293877|organism=Citrus clementina|type=EST|length=509bp
GTTGTTGAGCATTTAATTAGCGTCCCAGTTTGCCATAATGTCACTCATTC
CAAGCATCTTCGGGGGCCGAAGAACCAACGTGTTCGATCCAGTTTCATTA
GATGTATGGGATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGC
GCCGTCTTCGGCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACT
GGAAAGAGACTGCTCAGGCTCACGTATTCAAAGCTGATCTTCCAGGGCTG
AGGAAAGAAGAAGTAAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGAT
AAGCGGCGAGAGGAGCAAGGAGCATGAAGAGAAGAATGACAAGTGGCATC
GCGTCCAGAGGAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGAC
AATGCTAAGGTGGAACAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCAC
AGTCACCGTTCCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCTATTG
AGATCTCTG
back to top