CX293894
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD_CERCA (Glucose-6-phosphate 1-dehydrogenase OS=Ceratitis capitata GN=ZW PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.008e-11 Identity = 35/89 (39.33%), Postives = 49/89 (55.06%), Query Frame = 1 Query: 13 LDRSHLNLHYAARYSKE-IPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRW 276 ++ + L+L Y RY +PDAYERL+LD G + F+RSDEL AW +FTP + P Y +GSRGP A + N ++ Sbjct: 428 IEETELDLTYEHRYKNSYLPDAYERLILDVFCGSQMHFVRSDELSEAWRIFTPVLNEIENNKVKPIPYVFGSRGPKEADQKTSENNFKY 516
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD5_ARATH (Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=ACG9 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.008e-11 Identity = 36/79 (45.57%), Postives = 46/79 (58.23%), Query Frame = 1 Query: 19 RSHLNLHYAARYSK-EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYL 252 +S L+L Y RY IP+AYERL+LD I G+++ F+R DEL AAW +FTP + Y GSRGP A L Sbjct: 419 QSELDLSYKQRYQDVSIPEAYERLILDTIRGDQQHFVRRDELKAAWEIFTPLLHRIDKGEVKSVPYKQGSRGPAEADQL 497
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD_TAKRU (Glucose-6-phosphate 1-dehydrogenase OS=Takifugu rubripes GN=g6pd PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.929e-11 Identity = 37/88 (42.05%), Postives = 48/88 (54.55%), Query Frame = 1 Query: 16 DRSHLNLHYAARYSK-EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYLAARYNVRW 276 + + L+L Y +RY ++PDAYERL+LD G + F+ SDEL AW +FTP P Y YGSRGP A L R R+ Sbjct: 431 EETELDLTYKSRYKDVKLPDAYERLILDVFCGSQMHFVASDELREAWRIFTPLLHQIEKEKPKPIPYKYGSRGPAEADELEKRVGFRY 518
BLAST of CX293894 vs. ExPASy Swiss-Prot
Match: G6PD_MEDSA (Glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform OS=Medicago sativa PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.929e-11 Identity = 36/79 (45.57%), Postives = 47/79 (59.49%), Query Frame = 1 Query: 19 RSHLNLHYAARYSK-EIPDAYERLLLDAIEGERRLFIRSDELDAAWALFTPXXXXXXXXXIIPEYYPYGSRGPVGAHYL 252 +S L+L Y RY IP+AYERL+LD I G+++ F+R DEL A+W +FTP + P Y GSRGP A L Sbjct: 418 QSELDLSYGQRYQGITIPEAYERLILDTIRGDQQHFVRRDELKASWQIFTPLLHKIDRGELKPVPYNPGSRGPAEADEL 496 The following BLAST results are available for this feature:
BLAST of CX293894 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 24
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX293894 ID=CX293894; Name=CX293894; organism=Citrus clementina; type=EST; length=548bpback to top |