CX296733
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.448e-11 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = -3 Query: 287 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNF 403 GNM+V+EQENVKRVQLADKY+SEAALG+AN DAI+ G F Sbjct: 397 GNMLVEEQENVKRVQLADKYMSEAALGDANQDAIKRGTF 435
BLAST of CX296733 vs. ExPASy Swiss-Prot
Match: RCA_MAIZE (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Zea mays GN=RCA1 PE=2 SV=3) HSP 1 Score: 65.4698 bits (158), Expect = 9.910e-11 Identity = 30/40 (75.00%), Postives = 38/40 (95.00%), Query Frame = -3 Query: 284 GNMIVQEQENVKRVQLADKYLSEAALGEANADAIQSGNFY 403 G+M+V EQENVKRVQLADKYL+EAALGEAN DA+++G+F+ Sbjct: 393 GHMLVAEQENVKRVQLADKYLNEAALGEANEDAMKTGSFF 432 The following BLAST results are available for this feature:
BLAST of CX296733 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX296733 ID=CX296733; Name=CX296733; organism=Citrus clementina; type=EST; length=405bpback to top |